BLASTX nr result
ID: Zingiber24_contig00050697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050697 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404965.1| hypothetical protein EUTSA_v10000160mg [Eutr... 58 1e-06 ref|XP_006404964.1| hypothetical protein EUTSA_v10000160mg [Eutr... 58 1e-06 ref|XP_002528000.1| serine/thronine protein kinase, putative [Ri... 55 1e-05 gb|ABG45945.1| DSK2 [Nicotiana tabacum] 55 1e-05 >ref|XP_006404965.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|567191594|ref|XP_006404966.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|567191597|ref|XP_006404967.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|557106093|gb|ESQ46418.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|557106094|gb|ESQ46419.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|557106095|gb|ESQ46420.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 3 VRASFSDIVGMLESAEKEIVNSVRRARFRCCIQPMTFD 116 VR F++IV MLE AE EIVN++R+ARFRCC+QPMT D Sbjct: 366 VRPPFTEIVMMLERAEAEIVNNIRKARFRCCVQPMTTD 403 >ref|XP_006404964.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] gi|557106092|gb|ESQ46417.1| hypothetical protein EUTSA_v10000160mg [Eutrema salsugineum] Length = 456 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 3 VRASFSDIVGMLESAEKEIVNSVRRARFRCCIQPMTFD 116 VR F++IV MLE AE EIVN++R+ARFRCC+QPMT D Sbjct: 419 VRPPFTEIVMMLERAEAEIVNNIRKARFRCCVQPMTTD 456 >ref|XP_002528000.1| serine/thronine protein kinase, putative [Ricinus communis] gi|223532626|gb|EEF34412.1| serine/thronine protein kinase, putative [Ricinus communis] Length = 414 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 3 VRASFSDIVGMLESAEKEIVNSVRRARFRCCI-QPMTFD 116 VR F++IV MLE+AE EI+N+VR+ARFRCCI QPMT D Sbjct: 376 VRPPFTEIVRMLENAESEIMNTVRKARFRCCISQPMTVD 414 >gb|ABG45945.1| DSK2 [Nicotiana tabacum] Length = 406 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 6 RASFSDIVGMLESAEKEIVNSVRRARFRCCIQPMTFD 116 R FS +V MLE+AE EI+ +VR+ARFRCCIQPMT D Sbjct: 370 RPPFSQVVRMLEAAETEIMTTVRKARFRCCIQPMTTD 406