BLASTX nr result
ID: Zingiber24_contig00050596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050596 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG47411.1| maltose transporter [Malus domestica] 49 3e-06 gb|ESW03466.1| hypothetical protein PHAVU_011G016500g [Phaseolus... 48 6e-06 >gb|ABG47411.1| maltose transporter [Malus domestica] Length = 425 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +1 Query: 34 WFTGSA*ASFHQGRGNLFCLHSLNTISKEFFFGAT 138 WFTGS ASF G GN+ CL+ N+ISKEFF AT Sbjct: 357 WFTGSTWASFFYGYGNIVCLYWFNSISKEFFLAAT 391 Score = 27.7 bits (60), Expect(2) = 3e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 LLFMWMPVSQM 35 LLFMWMPVSQM Sbjct: 307 LLFMWMPVSQM 317 >gb|ESW03466.1| hypothetical protein PHAVU_011G016500g [Phaseolus vulgaris] Length = 399 Score = 47.8 bits (112), Expect(2) = 6e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +1 Query: 34 WFTGSA*ASFHQGRGNLFCLHSLNTISKEFFFGAT 138 WFTGSA A+ G GN+ CL+ LN ISKEFF AT Sbjct: 331 WFTGSAWATLFYGYGNIACLYFLNIISKEFFLAAT 365 Score = 27.7 bits (60), Expect(2) = 6e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 LLFMWMPVSQM 35 LLFMWMPVSQM Sbjct: 281 LLFMWMPVSQM 291