BLASTX nr result
ID: Zingiber24_contig00050474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050474 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT28872.1| hypothetical protein F775_03467 [Aegilops tauschii] 69 7e-10 emb|CBI26620.3| unnamed protein product [Vitis vinifera] 65 9e-09 >gb|EMT28872.1| hypothetical protein F775_03467 [Aegilops tauschii] Length = 241 Score = 68.9 bits (167), Expect = 7e-10 Identities = 39/46 (84%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 136 MLPIGTSGVGLTRNMEPIG-VTFR*ILKSTIEASEAASIEDTRQKE 2 M PIGTSGVGL N EPIG VTFR ILKSTIEASEAASIEDTR KE Sbjct: 1 MPPIGTSGVGLACNTEPIGGVTFRSILKSTIEASEAASIEDTRHKE 46 >emb|CBI26620.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 193 VIYNKVFMLLIPRCSASSPMLPIGTSGVGLTRNMEPIGV 77 VIYNKVF+LLIPRCSASSP+ IGTSGVGLT N+E IG+ Sbjct: 405 VIYNKVFVLLIPRCSASSPISTIGTSGVGLTSNIEHIGI 443