BLASTX nr result
ID: Zingiber24_contig00050449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050449 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata ... 100 3e-19 gb|EMS67607.1| Putative disease resistance protein RGA3 [Triticu... 62 8e-08 gb|EMT16817.1| Putative disease resistance protein RGA3 [Aegilop... 60 2e-07 >gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata subsp. malaccensis] Length = 1442 Score = 99.8 bits (247), Expect = 3e-19 Identities = 51/92 (55%), Positives = 67/92 (72%) Frame = +2 Query: 5 SFGKSLPGCLYSLSLLTRLSISNCPHMETLPGEAMLHLKQLWDVSIKSWDELRSIGGITF 184 + GKSLPGCL++LS L +L+ISNCP+M + P + MLHLK+L V I + D LRSI G+ Sbjct: 1222 NLGKSLPGCLHNLSSLIQLAISNCPYMVSFPRDVMLHLKELGAVRIMNCDGLRSIEGLQV 1281 Query: 185 LSTLTRLELADCPKLLLNGMVEEGKCSSLLEL 280 L +L RLE+ CP+LLLN E+G+ SLLEL Sbjct: 1282 LKSLKRLEIIGCPRLLLNEGDEQGEVLSLLEL 1313 >gb|EMS67607.1| Putative disease resistance protein RGA3 [Triticum urartu] Length = 1426 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/71 (40%), Positives = 45/71 (63%) Frame = +2 Query: 17 SLPGCLYSLSLLTRLSISNCPHMETLPGEAMLHLKQLWDVSIKSWDELRSIGGITFLSTL 196 SLP CL++L L L I NCP++ +LP E + L+ L + + + LRS+GG+ LS+L Sbjct: 1212 SLPSCLHNLPSLVSLIIYNCPNLLSLPAEIVSQLRSLRGMYVDNCSSLRSLGGLHHLSSL 1271 Query: 197 TRLELADCPKL 229 L + +CP+L Sbjct: 1272 INLHIVNCPRL 1282 >gb|EMT16817.1| Putative disease resistance protein RGA3 [Aegilops tauschii] Length = 900 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/71 (39%), Positives = 45/71 (63%) Frame = +2 Query: 17 SLPGCLYSLSLLTRLSISNCPHMETLPGEAMLHLKQLWDVSIKSWDELRSIGGITFLSTL 196 SLP CL+SL L L I NCP++ +LP E + ++ L + + + L+S+GG+ LS+L Sbjct: 686 SLPSCLHSLPSLESLIIYNCPNLLSLPAEIVSQMRSLRGMYVDNCSSLQSLGGLHHLSSL 745 Query: 197 TRLELADCPKL 229 L + +CP+L Sbjct: 746 INLHIVNCPRL 756