BLASTX nr result
ID: Zingiber24_contig00050435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050435 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004961314.1| PREDICTED: protein enabled homolog [Setaria ... 58 1e-06 >ref|XP_004961314.1| PREDICTED: protein enabled homolog [Setaria italica] Length = 265 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/82 (41%), Positives = 47/82 (57%) Frame = +3 Query: 45 APAKEEMPHREASDASTDLPWNLRTRHRVAREIERHRYGSPPPPTTTAKREVWLRSDDPK 224 AP K++ + A A+T PWNLR R R R R SP PP +++ R + Sbjct: 151 APQKQQEQPQAADAATTTRPWNLRERSR-RRPAPRSWAASPSPPPSSSSR---------R 200 Query: 225 KKERPRFSISLTREEIDEDIYA 290 +++R FS+SLT EEI+EDIYA Sbjct: 201 RRKRAPFSVSLTAEEIEEDIYA 222