BLASTX nr result
ID: Zingiber24_contig00050395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050395 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004961160.1| PREDICTED: ethylene-responsive transcription... 59 5e-07 gb|EAY99109.1| hypothetical protein OsI_21068 [Oryza sativa Indi... 56 6e-06 >ref|XP_004961160.1| PREDICTED: ethylene-responsive transcription factor ERF061-like [Setaria italica] Length = 279 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 2/67 (2%) Frame = -3 Query: 195 MEGIQETLSPAEIPSEISASLSKVLLS--GTNAIDSIFSHLPQPLPPVRSPAVPYLGSSV 22 M+ TLSPA P E+ +++S +LLS GT+A+D++FSHLP P+ +P LGSSV Sbjct: 1 MDASLRTLSPASFPGEVRSAVSSLLLSSPGTSALDTVFSHLPPPV------TIPPLGSSV 54 Query: 21 YLQQTEI 1 Y +Q E+ Sbjct: 55 YYRQCEL 61 >gb|EAY99109.1| hypothetical protein OsI_21068 [Oryza sativa Indica Group] Length = 272 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = -3 Query: 195 MEGIQETLSPAEIPSEISASLSKVLLS-GTNAIDSIFSHLPQPLPPVRSPAVPYLGSSVY 19 M+ TL PA P E+ +++S +LLS G +A+D++FSHLP P+ +P LGSSVY Sbjct: 1 MDASLRTLPPASFPGEVRSAVSSLLLSPGGSALDTVFSHLPPPV------TIPPLGSSVY 54 Query: 18 LQQTEI 1 +Q+E+ Sbjct: 55 YRQSEL 60