BLASTX nr result
ID: Zingiber24_contig00050315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00050315 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448988.1| hypothetical protein SORBIDRAFT_05g002950 [S... 56 6e-06 >ref|XP_002448988.1| hypothetical protein SORBIDRAFT_05g002950 [Sorghum bicolor] gi|241934831|gb|EES07976.1| hypothetical protein SORBIDRAFT_05g002950 [Sorghum bicolor] Length = 926 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/104 (31%), Positives = 54/104 (51%) Frame = +2 Query: 8 LPYLEVLDARLSRIIQLPSRLWRIATLKKVYVGSVEQPVKISKLGNSQSLRVVEWVDIAG 187 L L+ LD R + + +LP W I TL+ V+ + P ++ L N Q+L V+ D Sbjct: 653 LSSLQTLDVRDTEVKELPVPFWEIRTLRHVFGHRLILPKRVGVLKNLQTLDTVK-PDAKY 711 Query: 188 GWIERTENEISSFRKLGITGIQQAHRKALTRFLRKLRHLASLNL 319 GW T +++ R L I + + H K L L+KL++L +L + Sbjct: 712 GWDRNTLSKMIQLRSLFIWELSKGHEKGLVAALKKLKYLVTLTI 755