BLASTX nr result
ID: Zingiber24_contig00049543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00049543 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481142.1| PREDICTED: protein LURP-one-related 15-like ... 55 7e-06 ref|XP_006429529.1| hypothetical protein CICLE_v10013687mg [Citr... 55 7e-06 ref|XP_002533825.1| conserved hypothetical protein [Ricinus comm... 55 9e-06 >ref|XP_006481142.1| PREDICTED: protein LURP-one-related 15-like [Citrus sinensis] Length = 225 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 6/73 (8%) Frame = -2 Query: 311 DVVLANNTNPSAPCDFKMSGRC--KNGTICIGKSDEIIAQMHRK----TACFARDKREVT 150 DV LANNT CDF++ G ++ TI G+S IIAQMH+K + +D VT Sbjct: 122 DVFLANNTKEDV-CDFRVKGSWFERSCTIYAGESSTIIAQMHKKHTVQSILIGKDNFAVT 180 Query: 149 VNPNVDYVFILSL 111 V PN+DY FI++L Sbjct: 181 VYPNIDYAFIVAL 193 >ref|XP_006429529.1| hypothetical protein CICLE_v10013687mg [Citrus clementina] gi|557531586|gb|ESR42769.1| hypothetical protein CICLE_v10013687mg [Citrus clementina] Length = 226 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 6/73 (8%) Frame = -2 Query: 311 DVVLANNTNPSAPCDFKMSGRC--KNGTICIGKSDEIIAQMHRK----TACFARDKREVT 150 DV LANNT CDF++ G ++ TI G+S IIAQMH+K + +D VT Sbjct: 123 DVFLANNTKEDV-CDFRVKGSWFERSCTIYAGESSTIIAQMHKKHTVQSILIGKDNFAVT 181 Query: 149 VNPNVDYVFILSL 111 V PN+DY FI++L Sbjct: 182 VYPNIDYAFIVAL 194 >ref|XP_002533825.1| conserved hypothetical protein [Ricinus communis] gi|223526242|gb|EEF28560.1| conserved hypothetical protein [Ricinus communis] Length = 220 Score = 55.1 bits (131), Expect = 9e-06 Identities = 35/73 (47%), Positives = 45/73 (61%), Gaps = 6/73 (8%) Frame = -2 Query: 311 DVVLANNTNPSAPCDFKMSGRC--KNGTICIGKSDEIIAQMHRK----TACFARDKREVT 150 DV LA NT P DFK+ G ++ TI +G+++ IIAQMHRK T F D VT Sbjct: 129 DVCLAANTAEDVP-DFKVRGSWLERSCTIYLGQTNTIIAQMHRKHTLQTVVFDADNFGVT 187 Query: 149 VNPNVDYVFILSL 111 V PNVDY F+++L Sbjct: 188 VYPNVDYAFVVAL 200