BLASTX nr result
ID: Zingiber24_contig00049408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00049408 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29825.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 61 2e-07 ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [A... 57 3e-06 ref|XP_006301385.1| hypothetical protein CARUB_v10021797mg [Caps... 57 3e-06 ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citr... 55 7e-06 ref|XP_002308024.2| pentatricopeptide repeat-containing family p... 55 7e-06 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -2 Query: 230 FFDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAFRFFSWAS 51 F A G A + VL+V+ TV E L+ L+P L++ +V +V+ + P L FRFF W + Sbjct: 29 FTTAQGAAISNEVLTVMETVNPMEDALEKLAPFLSSEIVNDVMREQRRPELGFRFFIWTT 88 Query: 50 RQRHLRSWASYN 15 R+R RSW ++N Sbjct: 89 RRRSFRSWVTHN 100 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -2 Query: 230 FFDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAFRFFSWAS 51 F A G A + VL+V+ TV E L+ L+P L++ +V +V+ + P L FRFF W + Sbjct: 29 FTTAQGAAISNEVLTVMETVNPMEDALEKLAPFLSSEIVNDVMREQRRPELGFRFFIWTT 88 Query: 50 RQRHLRSWASYN 15 R+R RSW ++N Sbjct: 89 RRRSFRSWVTHN 100 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/71 (39%), Positives = 43/71 (60%) Frame = -2 Query: 227 FDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAFRFFSWASR 48 + A+ A + VL++I +V EP L+ P L+ ++V ++ + P L FRFF WAS+ Sbjct: 25 YSAVDFAISNEVLTIIDSVNPIEPALESKVPFLSPSIVTYIIKNPPNSLLGFRFFIWASK 84 Query: 47 QRHLRSWASYN 15 R LRSW S+N Sbjct: 85 FRRLRSWVSHN 95 >ref|XP_006848380.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] gi|548851686|gb|ERN09961.1| hypothetical protein AMTR_s00013p00202120 [Amborella trichopoda] Length = 789 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/68 (39%), Positives = 40/68 (58%) Frame = -2 Query: 209 AACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAFRFFSWASRQRHLRS 30 A + S++ V E L+ L+P+++ VVA VL + P+L FRFF W+SR L+S Sbjct: 32 AVSKEICSILKDVEVIETPLETLTPLISPNVVASVLKEEKDPKLGFRFFIWSSRHTALKS 91 Query: 29 WASYNGCI 6 W S+N I Sbjct: 92 WDSHNSMI 99 >ref|XP_006301385.1| hypothetical protein CARUB_v10021797mg [Capsella rubella] gi|482570095|gb|EOA34283.1| hypothetical protein CARUB_v10021797mg [Capsella rubella] Length = 780 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/78 (41%), Positives = 44/78 (56%) Frame = -2 Query: 251 SSSSGASFFDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAF 72 S SSG S F+ G V+S+++ EP L+ L P L+ ++ V+ D PRL F Sbjct: 23 SYSSGNSEFNISG-----EVISILAKKKPIEPALEPLVPFLSNKIITSVIKDEVNPRLGF 77 Query: 71 RFFSWASRQRHLRSWASY 18 RFF WASR+ LRS S+ Sbjct: 78 RFFIWASRRERLRSRDSF 95 >ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Citrus sinensis] Length = 869 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/83 (36%), Positives = 46/83 (55%) Frame = -2 Query: 254 HSSSSGASFFDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLA 75 HS SS S + + VL+++ TV EP L+ L P L+ V V+ P++ Sbjct: 97 HSPSSAES-------STINEVLTILDTVTPIEPALEPLLPFLSKTTVTSVIMKTKNPQVG 149 Query: 74 FRFFSWASRQRHLRSWASYNGCI 6 FRFF WA++++ LRS+AS + I Sbjct: 150 FRFFIWAAKRKRLRSFASNSAVI 172 >ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] gi|557523196|gb|ESR34563.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] Length = 801 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/83 (36%), Positives = 46/83 (55%) Frame = -2 Query: 254 HSSSSGASFFDALGLAACDRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLA 75 HS SS S + + VL+++ TV EP L+ L P L+ V V+ P++ Sbjct: 29 HSPSSAES-------STINEVLTILDTVTPIEPALEPLLPFLSKTTVTSVIMKTKNPQVG 81 Query: 74 FRFFSWASRQRHLRSWASYNGCI 6 FRFF WA++++ LRS+AS + I Sbjct: 82 FRFFIWAAKRKRLRSFASNSAVI 104 >ref|XP_002308024.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335473|gb|EEE91547.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 838 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/60 (40%), Positives = 36/60 (60%) Frame = -2 Query: 200 DRVLSVISTVPDFEPQLDFLSPILTTAVVAEVLADAPAPRLAFRFFSWASRQRHLRSWAS 21 D V +VI T+ EP L+ + P L+ +V ++ + P P+L FRFF WAS + R+W S Sbjct: 34 DEVFTVIKTMNPMEPALEPMVPFLSPKIVTSIIQNPPNPQLGFRFFIWASNFKRFRAWES 93