BLASTX nr result
ID: Zingiber24_contig00048909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048909 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23818.1| hypothetical protein PRUPE_ppa004170mg [Prunus pe... 61 2e-07 gb|EXC20007.1| SET and MYND domain-containing protein [Morus not... 59 9e-07 ref|XP_004298417.1| PREDICTED: uncharacterized protein LOC101301... 56 4e-06 >gb|EMJ23818.1| hypothetical protein PRUPE_ppa004170mg [Prunus persica] Length = 525 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -2 Query: 278 DERVLKAVLGRMKKGCGDVAEMEKAMRLGRATYGKIMKRTTMKALFQLPLL 126 DERVLK V+ ++KKG G V EME+A++LGR YGK++K+ MK L L +L Sbjct: 475 DERVLKMVVEKLKKGSGGVVEMERALKLGRGVYGKVVKKQAMKTLLGLGVL 525 >gb|EXC20007.1| SET and MYND domain-containing protein [Morus notabilis] Length = 536 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 2/50 (4%) Frame = -2 Query: 278 DERVLKAVLGRMKK--GCGDVAEMEKAMRLGRATYGKIMKRTTMKALFQL 135 DERVLK +L RMKK G G V EMEKA++LGR YGK MK+ MK L L Sbjct: 480 DERVLKILLDRMKKSGGSGGVVEMEKALKLGRGLYGKAMKKQAMKTLVDL 529 >ref|XP_004298417.1| PREDICTED: uncharacterized protein LOC101301002 [Fragaria vesca subsp. vesca] Length = 521 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -2 Query: 278 DERVLKAVLGRMKKGCG--DVAEMEKAMRLGRATYGKIMKRTTMKALFQLPLL 126 DERVLK V+ ++KKG G V E+E+A++LGR YGK+MK+ MK+L L +L Sbjct: 465 DERVLKMVVEKLKKGNGGSSVVEIERALKLGRGVYGKVMKKQAMKSLLGLGIL 517