BLASTX nr result
ID: Zingiber24_contig00048898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048898 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845691.1| hypothetical protein AMTR_s00019p00236850 [A... 60 2e-07 ref|XP_002532804.1| hypothetical protein RCOM_0172420 [Ricinus c... 56 6e-06 >ref|XP_006845691.1| hypothetical protein AMTR_s00019p00236850 [Amborella trichopoda] gi|548848263|gb|ERN07366.1| hypothetical protein AMTR_s00019p00236850 [Amborella trichopoda] Length = 301 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -3 Query: 121 MKKHVECHGRDSVRNTMLKHEDIFRQQVRELHRLYQVQK 5 M++ + H R+SV+NTMLKHE+IF++QVRELHRLY+VQK Sbjct: 54 MERFQDQHSRESVKNTMLKHEEIFKEQVRELHRLYRVQK 92 >ref|XP_002532804.1| hypothetical protein RCOM_0172420 [Ricinus communis] gi|223527446|gb|EEF29582.1| hypothetical protein RCOM_0172420 [Ricinus communis] Length = 301 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -3 Query: 193 SNSFAVTGAVKTSDSNALDQRRFPMKKHVECHGRDSVRNTMLKHEDIFRQQVRELHRLYQ 14 SN+F TG V S+ D R P K + D +R TM HEDIF+ QVRELHRLY Sbjct: 39 SNNFQSTGRVNEHHSSMND--RMPEKNNT-----DFIRKTMQIHEDIFKHQVRELHRLYS 91 Query: 13 VQKM 2 VQKM Sbjct: 92 VQKM 95