BLASTX nr result
ID: Zingiber24_contig00048670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048670 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853110.1| hypothetical protein AMTR_s00038p00132760 [A... 62 8e-08 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 gb|EPS67278.1| hypothetical protein M569_07494 [Genlisea aurea] 59 5e-07 ref|XP_006853118.1| hypothetical protein AMTR_s00038p00140720 [A... 58 1e-06 ref|XP_003607325.1| Pentatricopeptide repeat-containing protein ... 58 1e-06 >ref|XP_006853110.1| hypothetical protein AMTR_s00038p00132760 [Amborella trichopoda] gi|548856749|gb|ERN14577.1| hypothetical protein AMTR_s00038p00132760 [Amborella trichopoda] Length = 757 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/81 (39%), Positives = 47/81 (58%) Frame = -1 Query: 250 LIEMASKCGSNSSSFDHLLTFYTRTGKVEEAVEAFKSMVENDIFPCVESRNGLLLSMLRS 71 L+E + +C S+ FD +L YTR G V E+VEA+K +V N +FP +E N L ++R Sbjct: 172 LMETSKRCESHPQVFDLVLNGYTRHGSVPESVEAYKRLVSNGVFPSIECINLHLRKLVRL 231 Query: 70 GSYSTALELFEEMRDKGMNYD 8 A L+ EM D+G + D Sbjct: 232 DFVDEAWNLYREMVDRGADLD 252 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/85 (37%), Positives = 52/85 (61%), Gaps = 2/85 (2%) Frame = -1 Query: 250 LIEMASKCGSNSSS--FDHLLTFYTRTGKVEEAVEAFKSMVENDIFPCVESRNGLLLSML 77 L+E + + G S S F++LL Y R K+ +AVE F++++E+D+ P V N LL +M+ Sbjct: 153 LLECSGRYGFESDSRVFNYLLNSYVRANKIVDAVECFRTLLEHDVIPWVPIMNILLTAMV 212 Query: 76 RSGSYSTALELFEEMRDKGMNYDKF 2 R A +L++EM ++GM D F Sbjct: 213 RRNMICNARQLYDEMVERGMYGDCF 237 >gb|EPS67278.1| hypothetical protein M569_07494 [Genlisea aurea] Length = 771 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/80 (35%), Positives = 48/80 (60%) Frame = -1 Query: 241 MASKCGSNSSSFDHLLTFYTRTGKVEEAVEAFKSMVENDIFPCVESRNGLLLSMLRSGSY 62 M+ C N++++D L++ + + ++EEA E + + I P V + N LL SGS+ Sbjct: 376 MSRNCYPNAATYDVLISGFIKENRIEEATELSRVLTSKGILPDVSTFNTLLRGQCLSGSH 435 Query: 61 STALELFEEMRDKGMNYDKF 2 ++A+ELF EM+ KG D+F Sbjct: 436 TSAMELFSEMKSKGCKPDEF 455 >ref|XP_006853118.1| hypothetical protein AMTR_s00038p00140720 [Amborella trichopoda] gi|548856757|gb|ERN14585.1| hypothetical protein AMTR_s00038p00140720 [Amborella trichopoda] Length = 855 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/81 (35%), Positives = 47/81 (58%) Frame = -1 Query: 250 LIEMASKCGSNSSSFDHLLTFYTRTGKVEEAVEAFKSMVENDIFPCVESRNGLLLSMLRS 71 L+E + +C S+ FD +L YTR G V E++E + +V N +FP V N LL ++R Sbjct: 164 LLETSERCNSHPRVFDLVLNGYTRYGSVTESLETYHRLVSNGVFPSVGCINLLLNKLVRL 223 Query: 70 GSYSTALELFEEMRDKGMNYD 8 A +L+ EM ++G++ D Sbjct: 224 NFIDEAWDLYREMVERGVDLD 244 >ref|XP_003607325.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508380|gb|AES89522.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 834 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -1 Query: 250 LIEMASKCGSNSSS--FDHLLTFYTRTGKVEEAVEAFKSMVENDIFPCVESRNGLLLSML 77 L+E + + G S S F++LL + R K+ +AVE F++M+E+D+ P V N LL +M+ Sbjct: 137 LLECSGRYGFESDSRVFNYLLKSFVRVNKITDAVECFRTMLEHDLVPWVPIMNNLLTAMV 196 Query: 76 RSGSYSTALELFEEMRDKGMNYD 8 R A +L++EM ++G+ D Sbjct: 197 RRNMVCDARQLYDEMVERGIYGD 219