BLASTX nr result
ID: Zingiber24_contig00048505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048505 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003575225.1| PREDICTED: uncharacterized endoplasmic retic... 65 7e-09 ref|XP_004490092.1| PREDICTED: uncharacterized endoplasmic retic... 64 2e-08 ref|XP_006580937.1| PREDICTED: uncharacterized protein LOC100306... 64 2e-08 ref|NP_001238586.1| uncharacterized protein LOC100306677 [Glycin... 64 2e-08 gb|EOY01872.1| Uncharacterized protein TCM_011673 [Theobroma cacao] 64 3e-08 gb|EMT05885.1| hypothetical protein F775_31910 [Aegilops tauschii] 64 3e-08 gb|AFK35600.1| unknown [Lotus japonicus] 64 3e-08 ref|XP_006305622.1| hypothetical protein CARUB_v10010309mg [Caps... 63 4e-08 ref|NP_177584.1| uncharacterized protein [Arabidopsis thaliana] ... 63 4e-08 gb|ESW10164.1| hypothetical protein PHAVU_009G186100g [Phaseolus... 63 5e-08 gb|EOY21900.1| Uncharacterized protein isoform 2 [Theobroma cacao] 63 5e-08 gb|EOY21899.1| Uncharacterized protein isoform 1 [Theobroma cacao] 63 5e-08 ref|XP_004297289.1| PREDICTED: uncharacterized endoplasmic retic... 63 5e-08 ref|NP_564061.1| uncharacterized protein [Arabidopsis thaliana] ... 63 5e-08 gb|AFK33784.1| unknown [Lotus japonicus] 62 6e-08 ref|XP_002522464.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 gb|AFK45082.1| unknown [Medicago truncatula] 62 8e-08 ref|XP_002316127.2| hypothetical protein POPTR_0010s17380g [Popu... 62 8e-08 ref|XP_004514829.1| PREDICTED: uncharacterized endoplasmic retic... 62 1e-07 gb|EMJ13300.1| hypothetical protein PRUPE_ppa011770mg [Prunus pe... 62 1e-07 >ref|XP_003575225.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like [Brachypodium distachyon] Length = 184 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 LLDLEKHF FYGAYHSNP NV IH LFVWPIF Sbjct: 6 LLDLEKHFAFYGAYHSNPVNVFIHMLFVWPIF 37 >ref|XP_004490092.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like [Cicer arietinum] Length = 206 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +3 Query: 225 FSLVAKDLLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 FS+ L DLEKHF FYG+YHSNP N+ IH LFVWPIF Sbjct: 2 FSMGRTGLFDLEKHFAFYGSYHSNPINIAIHVLFVWPIF 40 >ref|XP_006580937.1| PREDICTED: uncharacterized protein LOC100306677 isoform X1 [Glycine max] Length = 192 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP NV IH+LFVWPI Sbjct: 3 LLDLEKHFAFYGAYHSNPMNVAIHTLFVWPI 33 >ref|NP_001238586.1| uncharacterized protein LOC100306677 [Glycine max] gi|255629251|gb|ACU14970.1| unknown [Glycine max] Length = 182 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP NV IH+LFVWPI Sbjct: 3 LLDLEKHFAFYGAYHSNPMNVAIHTLFVWPI 33 >gb|EOY01872.1| Uncharacterized protein TCM_011673 [Theobroma cacao] Length = 203 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLEKHF FYGAYHSNP N+ IH LFVWPIF Sbjct: 7 LFDLEKHFAFYGAYHSNPINIAIHMLFVWPIF 38 >gb|EMT05885.1| hypothetical protein F775_31910 [Aegilops tauschii] Length = 164 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 249 LDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 LDLE+HF FYGAYHSNP NV IH+LFVWPIF Sbjct: 8 LDLERHFAFYGAYHSNPVNVFIHALFVWPIF 38 >gb|AFK35600.1| unknown [Lotus japonicus] Length = 202 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLEKHF FYGAYHSNP N+ IH LFVWPIF Sbjct: 6 LFDLEKHFAFYGAYHSNPVNIAIHVLFVWPIF 37 >ref|XP_006305622.1| hypothetical protein CARUB_v10010309mg [Capsella rubella] gi|482574333|gb|EOA38520.1| hypothetical protein CARUB_v10010309mg [Capsella rubella] Length = 206 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP N+VIH +FVWPI Sbjct: 7 LLDLEKHFAFYGAYHSNPINIVIHIIFVWPI 37 >ref|NP_177584.1| uncharacterized protein [Arabidopsis thaliana] gi|12324798|gb|AAG52360.1|AC011765_12 hypothetical protein; 36691-35528 [Arabidopsis thaliana] gi|332197471|gb|AEE35592.1| uncharacterized protein AT1G74440 [Arabidopsis thaliana] Length = 208 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWP 335 LLDLEKHF FYGAYHSNP N++IH+LFVWP Sbjct: 7 LLDLEKHFAFYGAYHSNPINIIIHTLFVWP 36 >gb|ESW10164.1| hypothetical protein PHAVU_009G186100g [Phaseolus vulgaris] Length = 270 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP NV IH LFVWPI Sbjct: 81 LLDLEKHFAFYGAYHSNPINVAIHILFVWPI 111 >gb|EOY21900.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 196 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLE HF FYGAYHSNP N++IH+LFVWPIF Sbjct: 6 LFDLENHFAFYGAYHSNPINILIHTLFVWPIF 37 >gb|EOY21899.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 202 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLE HF FYGAYHSNP N++IH+LFVWPIF Sbjct: 6 LFDLENHFAFYGAYHSNPINILIHTLFVWPIF 37 >ref|XP_004297289.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like [Fragaria vesca subsp. vesca] Length = 200 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLEKHF FYGAYHSNP N+ IH +FVWPIF Sbjct: 6 LFDLEKHFAFYGAYHSNPINIAIHMIFVWPIF 37 >ref|NP_564061.1| uncharacterized protein [Arabidopsis thaliana] gi|6730712|gb|AAF27107.1|AC011809_16 Unknown protein [Arabidopsis thaliana] gi|15809884|gb|AAL06870.1| At1g18720/F6A14_17 [Arabidopsis thaliana] gi|17978859|gb|AAL47401.1| At1g18720/F6A14_17 [Arabidopsis thaliana] gi|332191631|gb|AEE29752.1| uncharacterized protein AT1G18720 [Arabidopsis thaliana] Length = 206 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLEKHF FYGAYHSNP N++IH +FVWPIF Sbjct: 7 LFDLEKHFAFYGAYHSNPINILIHIIFVWPIF 38 >gb|AFK33784.1| unknown [Lotus japonicus] Length = 192 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP N+ IH LFVWPI Sbjct: 3 LLDLEKHFAFYGAYHSNPINIAIHILFVWPI 33 >ref|XP_002522464.1| conserved hypothetical protein [Ricinus communis] gi|223538349|gb|EEF39956.1| conserved hypothetical protein [Ricinus communis] Length = 200 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 252 DLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 DLEKHF FYGAYHSNP NV+IH +FVWPIF Sbjct: 8 DLEKHFAFYGAYHSNPVNVLIHMIFVWPIF 37 >gb|AFK45082.1| unknown [Medicago truncatula] Length = 197 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP NV IH LFVWP+ Sbjct: 3 LLDLEKHFAFYGAYHSNPINVAIHILFVWPL 33 >ref|XP_002316127.2| hypothetical protein POPTR_0010s17380g [Populus trichocarpa] gi|118485204|gb|ABK94463.1| unknown [Populus trichocarpa] gi|550330009|gb|EEF02298.2| hypothetical protein POPTR_0010s17380g [Populus trichocarpa] Length = 203 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLEKH+ FYGAYHSNP N++IH +FVWPIF Sbjct: 6 LFDLEKHYAFYGAYHSNPINILIHMIFVWPIF 37 >ref|XP_004514829.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like [Cicer arietinum] Length = 197 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPI 338 LLDLEKHF FYGAYHSNP NV IH +FVWPI Sbjct: 3 LLDLEKHFAFYGAYHSNPINVAIHIVFVWPI 33 >gb|EMJ13300.1| hypothetical protein PRUPE_ppa011770mg [Prunus persica] Length = 197 Score = 61.6 bits (148), Expect = 1e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 246 LLDLEKHFEFYGAYHSNPANVVIHSLFVWPIF 341 L DLE+HF FYGAYHSNP N++IH+ FVWP+F Sbjct: 6 LFDLERHFAFYGAYHSNPVNILIHTFFVWPLF 37