BLASTX nr result
ID: Zingiber24_contig00048455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048455 (222 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat... 56 4e-06 ref|XP_003541414.2| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Glycine max] Length = 630 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/65 (50%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = +1 Query: 28 LRALSRNRGFRESIALYRDLLTAPPSHFPDDHTFPFLLKACA--SLPGDASEHGEGSQIH 201 LR LS+ R +RE++ LYR +L + S FP+ TFPFLLK+CA SLP A SQ+H Sbjct: 26 LRQLSKQRQYREALTLYRHMLRS--SFFPNTFTFPFLLKSCAFLSLPLAA------SQLH 77 Query: 202 AHVVK 216 AHV++ Sbjct: 78 AHVIR 82 >ref|XP_003541414.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Glycine max] Length = 636 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/71 (40%), Positives = 43/71 (60%) Frame = +1 Query: 4 DAFICSSFLRALSRNRGFRESIALYRDLLTAPPSHFPDDHTFPFLLKACASLPGDASEHG 183 D F+ + +RA S ++ +++LY+ +L++ P FPD TFPFLLK+CA L S Sbjct: 65 DLFLFNLIIRAFSLSQTPHNALSLYKKMLSSSPPIFPDTFTFPFLLKSCAKL----SLPR 120 Query: 184 EGSQIHAHVVK 216 G Q+H HV K Sbjct: 121 LGLQVHTHVFK 131