BLASTX nr result
ID: Zingiber24_contig00048421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048421 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_023062893.1| hypothetical protein [Clostridium thermocell... 66 5e-09 gb|ADI18134.1| hypothetical protein [uncultured Verrucomicrobial... 57 2e-06 >ref|WP_023062893.1| hypothetical protein [Clostridium thermocellum] gi|551232768|emb|CDG37541.1| hypothetical protein CTHBC1_2972 [Clostridium thermocellum BC1] Length = 157 Score = 65.9 bits (159), Expect = 5e-09 Identities = 38/63 (60%), Positives = 41/63 (65%) Frame = +3 Query: 96 VWVVFLLSAKVSSRRLTPGVWTMGLQSLTGFGKLVSPLAQSVLYSPW*TPEASPKAISGR 275 VW V L + K+ S LTP G+QSL GFG V PLAQSVLY EASPKAISGR Sbjct: 2 VWAVSLSTMKLISHSLTPKQHLDGIQSLRGFGNPVRPLAQSVLYLRQTLLEASPKAISGR 61 Query: 276 TSY 284 TSY Sbjct: 62 TSY 64 >gb|ADI18134.1| hypothetical protein [uncultured Verrucomicrobiales bacterium HF0200_39L05] Length = 76 Score = 57.4 bits (137), Expect = 2e-06 Identities = 37/73 (50%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Frame = -2 Query: 284 IAGSPRNSFRASLGGLPWAVKH*LG*GA---YQLTKPCQTLKTHGPYPGSQSA*ANFRRQ 114 IAGS RNSFRAS+G + + +G G+ YQ + L +H YPGSQSA RR+ Sbjct: 2 IAGSLRNSFRASVGTVLRGGRALIGLGSLTGYQNQLNSECLGSH--YPGSQSASDKIRRR 59 Query: 113 EENNPDRRLRSPN 75 E NNPD RLR PN Sbjct: 60 EGNNPDHRLRCPN 72