BLASTX nr result
ID: Zingiber24_contig00048376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048376 (281 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX96826.1| Tetratricopeptide repeat (TPR)-like superfamily p... 59 7e-07 >gb|EOX96826.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 955 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/62 (40%), Positives = 38/62 (61%) Frame = -2 Query: 187 AWLETLRSHARANSFHSALATYVDMTSAGVPPDHXXXXXXXXXXXXXXXASVGRQLHAAS 8 +W E+LRS+ R+N FH A+ TYV M+S+G+PPDH ++G+Q+HA Sbjct: 118 SWTESLRSNTRSNRFHQAILTYVSMSSSGIPPDHFAFPAVLKAVTALHDLALGKQIHAQV 177 Query: 7 VK 2 +K Sbjct: 178 LK 179