BLASTX nr result
ID: Zingiber24_contig00048343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048343 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306009.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_002517971.1| pentatricopeptide repeat-containing protein,... 97 2e-18 gb|EOX99345.1| Pentatricopeptide repeat (PPR) superfamily protei... 97 3e-18 gb|EMJ18275.1| hypothetical protein PRUPE_ppa000834mg [Prunus pe... 96 4e-18 ref|XP_003560231.1| PREDICTED: pentatricopeptide repeat-containi... 96 5e-18 ref|XP_002319373.2| hypothetical protein POPTR_0013s14110g [Popu... 95 8e-18 tpg|DAA62526.1| TPA: hypothetical protein ZEAMMB73_338715 [Zea m... 94 1e-17 ref|NP_001169278.1| uncharacterized protein LOC100383141 [Zea ma... 94 1e-17 gb|EXB62281.1| hypothetical protein L484_022169 [Morus notabilis] 94 2e-17 ref|XP_006491629.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_006447317.1| hypothetical protein CICLE_v10017547mg [Citr... 94 2e-17 gb|EMT09623.1| hypothetical protein F775_05869 [Aegilops tauschii] 92 7e-17 ref|XP_002462845.1| hypothetical protein SORBIDRAFT_02g033010 [S... 91 1e-16 ref|XP_002272784.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 emb|CAN75708.1| hypothetical protein VITISV_031421 [Vitis vinifera] 91 1e-16 ref|XP_006357522.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_004959665.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_004243803.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 gb|EPS73099.1| hypothetical protein M569_01654 [Genlisea aurea] 88 1e-15 ref|XP_004141647.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 >ref|XP_004306009.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Fragaria vesca subsp. vesca] Length = 1000 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/82 (56%), Positives = 61/82 (74%) Frame = +2 Query: 5 DKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCER 184 +KM R I PDT+T+NIF+S+YA +GNI++ L Y K+ E GL PDTVSHR IL LCER Sbjct: 379 NKMEERGISPDTRTYNIFLSLYADMGNIDAALDCYRKIREVGLYPDTVSHRTILHVLCER 438 Query: 185 NMVREVEDVINKIIESGEFVDE 250 NM+R+VE VI + +SG ++E Sbjct: 439 NMIRDVEIVIEDMEKSGVSINE 460 >ref|XP_002517971.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542953|gb|EEF44489.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1029 Score = 97.1 bits (240), Expect = 2e-18 Identities = 46/82 (56%), Positives = 61/82 (74%) Frame = +2 Query: 5 DKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCER 184 +KM R + PDT+T+NIF+S+YA GNI++ +K Y K+ E GL PDTVSHR IL LCER Sbjct: 401 NKMEDRGVSPDTRTYNIFLSLYADEGNIDAAIKCYKKIREVGLLPDTVSHRAILHELCER 460 Query: 185 NMVREVEDVINKIIESGEFVDE 250 NMV+E E +I +I +S + VDE Sbjct: 461 NMVKEAEAIIEEIEKSSKQVDE 482 >gb|EOX99345.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 1007 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/81 (55%), Positives = 60/81 (74%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 KM + I PDTKT+NIF+S+YA GNIE+ L+YY K+ + GL PD V+HR +L LCERN Sbjct: 389 KMEEKGIPPDTKTYNIFLSLYAGAGNIEAALEYYRKIRKVGLFPDIVTHRAVLHILCERN 448 Query: 188 MVREVEDVINKIIESGEFVDE 250 MV+EVE VI ++ + G +DE Sbjct: 449 MVQEVETVIEEMNKFGIHIDE 469 >gb|EMJ18275.1| hypothetical protein PRUPE_ppa000834mg [Prunus persica] Length = 987 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/81 (55%), Positives = 59/81 (72%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 KM R I PDT+T+NIF+S+YA GNI++ L Y K+ E GL+PD VSHR +L LCERN Sbjct: 404 KMEERGISPDTRTYNIFLSLYADAGNIDAALNCYRKIREVGLSPDIVSHRTVLHVLCERN 463 Query: 188 MVREVEDVINKIIESGEFVDE 250 MV++VE VI + +SG +DE Sbjct: 464 MVQDVETVIRSMEKSGVRIDE 484 >ref|XP_003560231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Brachypodium distachyon] Length = 922 Score = 95.9 bits (237), Expect = 5e-18 Identities = 41/75 (54%), Positives = 59/75 (78%) Frame = +2 Query: 20 RRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERNMVRE 199 R + PD KT+N+ M+++AS+G++E VLKYYH++ +GL D VS+R++LQ LCER MVRE Sbjct: 336 RGVTPDIKTYNVMMTVFASMGDVEGVLKYYHQIGRTGLCADVVSYRVVLQVLCERKMVRE 395 Query: 200 VEDVINKIIESGEFV 244 EDVI +I++SG V Sbjct: 396 AEDVIEEIMQSGTCV 410 >ref|XP_002319373.2| hypothetical protein POPTR_0013s14110g [Populus trichocarpa] gi|550325820|gb|EEE95296.2| hypothetical protein POPTR_0013s14110g [Populus trichocarpa] Length = 965 Score = 95.1 bits (235), Expect = 8e-18 Identities = 46/81 (56%), Positives = 58/81 (71%) Frame = +2 Query: 5 DKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCER 184 DKM RRI PDT+T+NIF+S+YA GNI + L+ Y K+ GL PD VSHR IL LC R Sbjct: 346 DKMEERRISPDTRTYNIFLSLYADAGNINAALECYWKIRNVGLVPDIVSHRTILHILCGR 405 Query: 185 NMVREVEDVINKIIESGEFVD 247 NMVREVE VI ++ +S + +D Sbjct: 406 NMVREVEAVIEEMKKSSQKID 426 >tpg|DAA62526.1| TPA: hypothetical protein ZEAMMB73_338715 [Zea mays] Length = 901 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/83 (51%), Positives = 62/83 (74%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M R + PDTKT+N+ M+++AS+G++E VLKYY ++ +GL PD V++RI+LQ LCE Sbjct: 322 FASMVIRGVKPDTKTYNVMMTVFASIGDLEGVLKYYCQIRNAGLHPDAVTYRILLQVLCE 381 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 R MV + EDVI I+++G FV E Sbjct: 382 RKMVHKAEDVIEGILKAGSFVHE 404 >ref|NP_001169278.1| uncharacterized protein LOC100383141 [Zea mays] gi|224028343|gb|ACN33247.1| unknown [Zea mays] Length = 901 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/83 (51%), Positives = 62/83 (74%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M R + PDTKT+N+ M+++AS+G++E VLKYY ++ +GL PD V++RI+LQ LCE Sbjct: 322 FASMVIRGVKPDTKTYNVMMTVFASIGDLEGVLKYYCQIRNAGLHPDAVTYRILLQVLCE 381 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 R MV + EDVI I+++G FV E Sbjct: 382 RKMVHKAEDVIEGILKAGSFVHE 404 >gb|EXB62281.1| hypothetical protein L484_022169 [Morus notabilis] Length = 1018 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/81 (54%), Positives = 60/81 (74%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 KM RRI PDTKT+NIF+S+YA +G+I+ L+ Y K+ + GL PD V+HR +L LC+RN Sbjct: 397 KMEERRISPDTKTYNIFLSLYAEVGDIDKSLECYRKIRDVGLYPDLVTHRAVLHVLCQRN 456 Query: 188 MVREVEDVINKIIESGEFVDE 250 MVR+VE VI + +SG +DE Sbjct: 457 MVRDVEIVIEDMEKSGVRIDE 477 >ref|XP_006491629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Citrus sinensis] Length = 1004 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/83 (54%), Positives = 60/83 (72%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M RRI PDTKT+NIF+S+YA +GNI + L+YY K+ E GL PD+V+ R IL LC+ Sbjct: 384 FCMMEERRISPDTKTYNIFLSLYADVGNINAALRYYWKIREVGLFPDSVTQRAILHILCQ 443 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 RNMV+E E VI ++ + G +DE Sbjct: 444 RNMVQEAEAVIIEMEKCGLHIDE 466 >ref|XP_006447317.1| hypothetical protein CICLE_v10017547mg [Citrus clementina] gi|557549928|gb|ESR60557.1| hypothetical protein CICLE_v10017547mg [Citrus clementina] Length = 962 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/83 (54%), Positives = 60/83 (72%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M RRI PDTKT+NIF+S+YA +GNI + L+YY K+ E GL PD+V+ R IL LC+ Sbjct: 384 FCMMEERRISPDTKTYNIFLSLYADVGNINAALRYYWKIREVGLFPDSVTQRAILHILCQ 443 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 RNMV+E E VI ++ + G +DE Sbjct: 444 RNMVQEAEAVIIEMEKCGLHIDE 466 >gb|EMT09623.1| hypothetical protein F775_05869 [Aegilops tauschii] Length = 851 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/77 (54%), Positives = 56/77 (72%) Frame = +2 Query: 20 RRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERNMVRE 199 R I PD +T+N+ M ++AS+G+ E VLKYYH++ GL D VS+RI+LQ LCER +VRE Sbjct: 261 RGITPDIRTYNVMMMLFASMGDAEGVLKYYHQIGRIGLCADAVSYRIVLQVLCERKLVRE 320 Query: 200 VEDVINKIIESGEFVDE 250 EDVI II+SG + E Sbjct: 321 AEDVIEGIIKSGTSIHE 337 >ref|XP_002462845.1| hypothetical protein SORBIDRAFT_02g033010 [Sorghum bicolor] gi|241926222|gb|EER99366.1| hypothetical protein SORBIDRAFT_02g033010 [Sorghum bicolor] Length = 798 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/83 (51%), Positives = 61/83 (73%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M R + PDTKT+N+ M+++AS+G++E VLKYY+++ ++ L PD VS+RI+LQ LCE Sbjct: 243 FASMMVRGVKPDTKTYNVMMTVFASIGDLERVLKYYYQIGKACLHPDAVSYRILLQLLCE 302 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 R M EVED+I I+ SG V E Sbjct: 303 RKMAHEVEDLIEGILSSGCSVHE 325 >ref|XP_002272784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Vitis vinifera] Length = 1008 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/81 (56%), Positives = 57/81 (70%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 +M R I PDTKT+NIF+S+YA GNI++ LK Y K+ E GL PD V+HR +L LCERN Sbjct: 405 EMEERGISPDTKTYNIFLSLYADGGNIDAALKCYRKIREVGLFPDVVTHRAVLHVLCERN 464 Query: 188 MVREVEDVINKIIESGEFVDE 250 MV EVE VI ++ S VDE Sbjct: 465 MVGEVETVIAEMKRSRVRVDE 485 >emb|CAN75708.1| hypothetical protein VITISV_031421 [Vitis vinifera] Length = 1313 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/81 (56%), Positives = 57/81 (70%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 +M R I PDTKT+NIF+S+YA GNI++ LK Y K+ E GL PD V+HR +L LCERN Sbjct: 710 EMEERGISPDTKTYNIFLSLYADGGNIDAALKCYRKIREVGLFPDVVTHRAVLHVLCERN 769 Query: 188 MVREVEDVINKIIESGEFVDE 250 MV EVE VI ++ S VDE Sbjct: 770 MVGEVETVIAEMKRSRVRVDE 790 >ref|XP_006357522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like isoform X1 [Solanum tuberosum] gi|565382385|ref|XP_006357523.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like isoform X2 [Solanum tuberosum] Length = 1012 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/82 (50%), Positives = 62/82 (75%) Frame = +2 Query: 5 DKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCER 184 +KM R I PDTKT+NIF+S+YA+ G I+ L++Y K+ +GL PD V+ R I++ LC++ Sbjct: 388 NKMEERGISPDTKTYNIFLSLYANAGKIDRALQWYRKIRRTGLFPDAVTCRAIIRTLCKQ 447 Query: 185 NMVREVEDVINKIIESGEFVDE 250 NMV+EVE+VI++I G ++DE Sbjct: 448 NMVQEVENVISEIESLGMYIDE 469 >ref|XP_004959665.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Setaria italica] Length = 911 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/83 (53%), Positives = 60/83 (72%) Frame = +2 Query: 2 FDKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCE 181 F M R I PDTKTFN+ M+++AS+G+++ +LKYY ++ ++GL D VS RI+L+ALCE Sbjct: 321 FANMVVRGINPDTKTFNVMMTVFASIGDLDGILKYYRQIGKAGLHVDAVSSRIMLRALCE 380 Query: 182 RNMVREVEDVINKIIESGEFVDE 250 R MV E EDVI I+ SG V E Sbjct: 381 RKMVHEAEDVIEGILNSGGSVHE 403 >ref|XP_004243803.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Solanum lycopersicum] Length = 1014 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/82 (48%), Positives = 61/82 (74%) Frame = +2 Query: 5 DKMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCER 184 +KM R I PDTKT+NIF+S+YA+ I+ L++Y K+ +GL PD V+ R I++ LC++ Sbjct: 388 NKMEERGISPDTKTYNIFLSLYANAAKIDRALQWYRKIRRTGLFPDAVTCRAIIRTLCKQ 447 Query: 185 NMVREVEDVINKIIESGEFVDE 250 NMV+EVE+VI++I G ++DE Sbjct: 448 NMVQEVENVISEIESLGMYIDE 469 >gb|EPS73099.1| hypothetical protein M569_01654 [Genlisea aurea] Length = 1119 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/82 (53%), Positives = 59/82 (71%), Gaps = 1/82 (1%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 +M R I PDTKT+NIF+++YA GNIE+ L+ Y + E+GL PD V+ R L+ LCERN Sbjct: 521 EMEERGIEPDTKTYNIFITLYAESGNIEAALRSYRMIRETGLLPDEVTRRTTLRILCERN 580 Query: 188 MVREVEDVINKIIES-GEFVDE 250 MV+EVED+I + E G+ VDE Sbjct: 581 MVQEVEDLIRETEEEFGDRVDE 602 >ref|XP_004141647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g73710-like [Cucumis sativus] Length = 1020 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/81 (51%), Positives = 58/81 (71%) Frame = +2 Query: 8 KMRRRRIVPDTKTFNIFMSMYASLGNIESVLKYYHKMSESGLTPDTVSHRIILQALCERN 187 KM R + PDTKT+NIF+S+YA+ GNI+ LK Y ++ E GL PD V+HR +L L ERN Sbjct: 381 KMEERGLSPDTKTYNIFLSLYANNGNIDGALKCYRRIREVGLFPDVVTHRALLHVLSERN 440 Query: 188 MVREVEDVINKIIESGEFVDE 250 MV +VE+VI ++ +S +DE Sbjct: 441 MVEDVENVIAEMEKSHILLDE 461