BLASTX nr result
ID: Zingiber24_contig00048259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048259 (342 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006388556.1| hypothetical protein POPTR_0157s00210g [Popu... 55 1e-05 >ref|XP_006388556.1| hypothetical protein POPTR_0157s00210g [Populus trichocarpa] gi|550310389|gb|ERP47470.1| hypothetical protein POPTR_0157s00210g [Populus trichocarpa] Length = 843 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/72 (41%), Positives = 42/72 (58%) Frame = -3 Query: 340 TTCPNQGSVLSPDTRSLNAKSFWGLFLITGAVSLLCCLFYSLRSVYRDRLSLTGVVSGRS 161 +TCP GS +S + SL+ KSFWGLFLI G +LL + + + VYR+R L S S Sbjct: 707 STCPESGSSIS--SNSLSLKSFWGLFLIAGLAALLALIIFIVMFVYRERNVLRSSDSTAS 764 Query: 160 FGRRLLSIARLF 125 R+ + R+F Sbjct: 765 IWSRIRNFFRIF 776