BLASTX nr result
ID: Zingiber24_contig00048032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00048032 (550 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006659933.1| PREDICTED: GTP-binding protein ERG-like, par... 61 2e-07 ref|XP_002444026.1| hypothetical protein SORBIDRAFT_07g006070 [S... 60 5e-07 dbj|BAD12850.1| putative GTP-binding protein ERG [Oryza sativa J... 59 8e-07 gb|AFW56995.1| hypothetical protein ZEAMMB73_674370 [Zea mays] 59 8e-07 gb|AFW56992.1| hypothetical protein ZEAMMB73_674370 [Zea mays] g... 59 8e-07 gb|ACN34076.1| unknown [Zea mays] gi|413921066|gb|AFW60998.1| hy... 59 8e-07 ref|NP_001167959.1| uncharacterized protein LOC100381675 [Zea ma... 59 8e-07 gb|EEC83096.1| hypothetical protein OsI_28232 [Oryza sativa Indi... 59 8e-07 gb|EAZ08151.1| hypothetical protein OsI_30415 [Oryza sativa Indi... 59 8e-07 ref|XP_004972587.1| PREDICTED: GTP-binding protein ERG-like [Set... 58 1e-06 gb|EMS67900.1| GTP-binding protein ERG [Triticum urartu] 57 4e-06 ref|XP_003573547.1| PREDICTED: GTP-binding protein ERG-like [Bra... 57 4e-06 gb|EMT30639.1| GTP-binding protein ERG [Aegilops tauschii] 56 7e-06 >ref|XP_006659933.1| PREDICTED: GTP-binding protein ERG-like, partial [Oryza brachyantha] Length = 396 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KRNA Sbjct: 363 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRNA 396 >ref|XP_002444026.1| hypothetical protein SORBIDRAFT_07g006070 [Sorghum bicolor] gi|241940376|gb|EES13521.1| hypothetical protein SORBIDRAFT_07g006070 [Sorghum bicolor] Length = 435 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA++RNA Sbjct: 402 IGRIGIEANEELRSIFKRDVHLILQVRVAKRRNA 435 >dbj|BAD12850.1| putative GTP-binding protein ERG [Oryza sativa Japonica Group] Length = 437 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 404 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 437 >gb|AFW56995.1| hypothetical protein ZEAMMB73_674370 [Zea mays] Length = 291 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 258 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 291 >gb|AFW56992.1| hypothetical protein ZEAMMB73_674370 [Zea mays] gi|413917061|gb|AFW56993.1| hypothetical protein ZEAMMB73_674370 [Zea mays] gi|413917062|gb|AFW56994.1| hypothetical protein ZEAMMB73_674370 [Zea mays] Length = 437 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 404 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 437 >gb|ACN34076.1| unknown [Zea mays] gi|413921066|gb|AFW60998.1| hypothetical protein ZEAMMB73_697996 [Zea mays] gi|413921067|gb|AFW60999.1| hypothetical protein ZEAMMB73_697996 [Zea mays] Length = 439 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 406 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 439 >ref|NP_001167959.1| uncharacterized protein LOC100381675 [Zea mays] gi|223945135|gb|ACN26651.1| unknown [Zea mays] Length = 165 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 132 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 165 >gb|EEC83096.1| hypothetical protein OsI_28232 [Oryza sativa Indica Group] Length = 437 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 404 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 437 >gb|EAZ08151.1| hypothetical protein OsI_30415 [Oryza sativa Indica Group] gi|125602548|gb|EAZ41873.1| hypothetical protein OsJ_26418 [Oryza sativa Japonica Group] Length = 69 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHLILQVRVA+KR+A Sbjct: 36 IGRIGIEANEELRSIFKRDVHLILQVRVAKKRSA 69 >ref|XP_004972587.1| PREDICTED: GTP-binding protein ERG-like [Setaria italica] Length = 437 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFKK VHLILQVRVA++R+A Sbjct: 404 IGRIGIEANEELRSIFKKNVHLILQVRVAKRRSA 437 >gb|EMS67900.1| GTP-binding protein ERG [Triticum urartu] Length = 325 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHL+LQVRVA+KR++ Sbjct: 292 IGRIGIEANEELRSIFKRDVHLMLQVRVAKKRSS 325 >ref|XP_003573547.1| PREDICTED: GTP-binding protein ERG-like [Brachypodium distachyon] Length = 429 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 547 IWRIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 I RIGIEANEELRSIFK++VHL+LQVRVA+KR++ Sbjct: 396 IGRIGIEANEELRSIFKRDVHLMLQVRVAKKRSS 429 >gb|EMT30639.1| GTP-binding protein ERG [Aegilops tauschii] Length = 247 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 541 RIGIEANEELRSIFKKEVHLILQVRVARKRNA 446 RIGIEANEELRSIFK++VHL+LQVRVA+KR++ Sbjct: 216 RIGIEANEELRSIFKRDVHLMLQVRVAKKRSS 247