BLASTX nr result
ID: Zingiber24_contig00047951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00047951 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB75200.1| hypothetical protein L484_025980 [Morus notabilis] 55 7e-06 >gb|EXB75200.1| hypothetical protein L484_025980 [Morus notabilis] Length = 396 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 325 SLVVQTGFPTSLADLFLKNRSRLKVPSRKKRKKLPET 215 SLVV+TGFPTSL DLF+KNR RLK PS KK+KK +T Sbjct: 28 SLVVETGFPTSLIDLFVKNRDRLKKPSIKKKKKKKKT 64