BLASTX nr result
ID: Zingiber24_contig00047713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00047713 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB91216.1| Outer envelope protein 80 [Morus notabilis] 56 4e-06 >gb|EXB91216.1| Outer envelope protein 80 [Morus notabilis] Length = 361 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 247 MGAQKSIQAGKAKIDFNVDLTQKLCGELLLPHIR 348 MGAQKSI AGKAKID NVD T KLC L++PH+R Sbjct: 1 MGAQKSIHAGKAKIDVNVDFTHKLCASLMVPHLR 34