BLASTX nr result
ID: Zingiber24_contig00047113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00047113 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445319.1| hypothetical protein CICLE_v10021511mg [Citr... 56 4e-06 gb|EXB37095.1| hypothetical protein L484_020887 [Morus notabilis] 55 7e-06 >ref|XP_006445319.1| hypothetical protein CICLE_v10021511mg [Citrus clementina] gi|568875561|ref|XP_006490861.1| PREDICTED: DNA ligase 1-like [Citrus sinensis] gi|557547581|gb|ESR58559.1| hypothetical protein CICLE_v10021511mg [Citrus clementina] Length = 286 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 3 RLALAHDFSWTEDELFSMIQCFDSDGDGKVLL 98 R+++AHDF WT+DELF MI CFDSDGDGK+ L Sbjct: 242 RVSVAHDFIWTDDELFDMIHCFDSDGDGKLNL 273 >gb|EXB37095.1| hypothetical protein L484_020887 [Morus notabilis] Length = 296 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +3 Query: 3 RLALAHDFSWTEDELFSMIQCFDSDGDGKVLL 98 R+A AHDF+WT++EL+ MI+CFDSDGDGK+ L Sbjct: 246 RVAKAHDFTWTDEELYDMIRCFDSDGDGKLSL 277