BLASTX nr result
ID: Zingiber24_contig00047072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00047072 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 72 8e-11 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 71 2e-10 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 69 6e-10 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 69 8e-10 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 67 2e-09 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 67 2e-09 ref|NP_001119115.1| conserved peptide upstream open reading fram... 66 4e-09 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 66 5e-09 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 66 5e-09 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 65 9e-09 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 65 9e-09 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 65 1e-08 ref|NP_001117603.1| conserved peptide upstream open reading fram... 65 1e-08 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 63 4e-08 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 63 5e-08 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 61 1e-07 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 60 2e-07 gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus... 59 7e-07 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 59 9e-07 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP+LSEIL SGFMINS+LRRRTHLVQSFSVVFLYWF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP++SEIL SGFMINS+LRRRTHLVQSFSVVFLYWF Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MS ILSE+ LSGFMINST RRRTHLVQSFSVVFLYWF Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWF 37 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 M+P++SE+LLSGF INSTLRR THLVQSFSVVFLYWF Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWF 37 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 307 SPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 SP++SEILLSGF INS+LRRRTHLVQSFSVVFL+WF Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWF 38 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP+LSEIL SGF+I+S+L+RRTHLVQSFSVVFLYWF Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWF 37 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/37 (89%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = +1 Query: 304 MSPI-LSEILLSGFMINSTLRRRTHLVQSFSVVFLYW 411 MSPI LSEI LSGFM+NST+RRRTHLVQSFSVVFLYW Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYW 37 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MS ILSE LLSGF+INS+ RRRTHLVQSFS+VFLYWF Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWF 37 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MS IL+E+ L GFMINST RRRTHLVQSFSVVFLYWF Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWF 37 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MS ILSE +LSGFMINSTLRR THLV SFSVVFLYWF Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWF 37 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP++ EI SGFMINSTLRRRTHLVQSFSVVFLYWF Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWF 35 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP++SEIL SG I+S+LRRRTHLVQSFSVVFLYWF Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWF 49 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 MSP++SEIL SG I+S+LRRRTHLVQSFSVVFLYWF Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWF 37 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYW 411 MSP LSE+LLS MINST RRRTHLVQSFSVVFLYW Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYW 36 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYW 411 M PILSEI SG MINST+RRRTHLVQSFSV FLYW Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYW 36 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYW 411 M ILSEI SG MINST+RRRTHLVQSFSVVFLYW Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYW 36 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 M+P+L EILLSG + S L RRTHLVQSFSVVFLYWF Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWF 37 >gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYW 411 M ILSE+ SG MINST+RRRTHLVQSFSV FLYW Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYW 36 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +1 Query: 304 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWF 414 M ILSEI SG MINST+RRRTHLVQSFSVVFLY F Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCF 37