BLASTX nr result
ID: Zingiber24_contig00047052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00047052 (296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521899.1| PREDICTED: UPF0187 protein At3g61320, chloro... 56 6e-06 >ref|XP_003521899.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic-like [Glycine max] Length = 446 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 10/71 (14%) Frame = +1 Query: 112 FAPRIPL----------TPRAPHILCSSSDPPTDAEAPSLVRFLRSFPDWTDAVKELGVR 261 F P+ PL P P I S PT A +L+ LRS PDW DAV+E G++ Sbjct: 53 FTPKCPLHQNILLLPSWKPAKPTISASLPPGPTSGPAQTLISLLRSIPDWADAVQERGMQ 112 Query: 262 KRRHLYTPDDW 294 K+R LYT +W Sbjct: 113 KKRALYTHQNW 123