BLASTX nr result
ID: Zingiber24_contig00046785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046785 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 95 8e-18 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 95.1 bits (235), Expect = 8e-18 Identities = 52/87 (59%), Positives = 60/87 (68%), Gaps = 5/87 (5%) Frame = +1 Query: 97 RTCKQRMLMFLFV---FFLPSCFSISNQDKPGTTVRREKTRSHSDLDMWNRLAPYVLK*F 267 R K+ +FL + F+PSC SI NQDKPGTTVRRE TRSHSDLDMWNRLAPYVLK F Sbjct: 540 RVKKENSSIFLSLPVEHFVPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLF 599 Query: 268 GRHGQ--SPKKEVKKMICKIEFFISLR 342 GRHG+ PK+E + E F +R Sbjct: 600 GRHGKISRPKEEGNEWDKTHEIFEHIR 626 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 285 ALTMSPELFQYIWRKTIPHIEVGMGSGLFTSYRSARFVLIGD 160 A TMSPE QYIWRKTIPHIEVGMGSG+FTSYRSARFVLI D Sbjct: 43 AWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84