BLASTX nr result
ID: Zingiber24_contig00046746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046746 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852320.1| hypothetical protein AMTR_s00049p00202480 [A... 55 7e-06 ref|XP_002312675.2| hypothetical protein POPTR_0008s19090g [Popu... 55 1e-05 >ref|XP_006852320.1| hypothetical protein AMTR_s00049p00202480 [Amborella trichopoda] gi|548855924|gb|ERN13787.1| hypothetical protein AMTR_s00049p00202480 [Amborella trichopoda] Length = 692 Score = 55.5 bits (132), Expect = 7e-06 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +1 Query: 1 NEVLSSDFRIVIDSSMVLSSIYPESF-GQLASNLTTIADNEEEINWRRRGNLQLSALYGS 177 NE LSS+ R V D+S V+SS + E +S L + E NW GN LSA YGS Sbjct: 234 NEALSSNLRFVFDASEVISSFFSEIIVHHHSSYLRNSEVMDREKNWEYEGNADLSASYGS 293 Query: 178 LSFPQTNLLNKPLKVVKCFSKY 243 F N K +K+V+C +Y Sbjct: 294 FYFRPINFSKKLVKLVRCDGQY 315 >ref|XP_002312675.2| hypothetical protein POPTR_0008s19090g [Populus trichocarpa] gi|550333439|gb|EEE90042.2| hypothetical protein POPTR_0008s19090g [Populus trichocarpa] Length = 552 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/102 (30%), Positives = 56/102 (54%), Gaps = 3/102 (2%) Frame = +1 Query: 1 NEVLSSDFRIVIDSSMVLSSI---YPESFGQLASNLTTIADNEEEINWRRRGNLQLSALY 171 NE +SS+ R+V D+S +S + YPE + +L+ +++ + E +W GN L ALY Sbjct: 125 NEAVSSELRLVFDASWTISCLSLNYPEHWSELSVRGSSVLEIENR-SWEEGGNSHLGALY 183 Query: 172 GSLSFPQTNLLNKPLKVVKCFSKYYLVDQLKGTIYFSQVSVG 297 GS+ F + N + + ++ C +Y D+ + ++Y S G Sbjct: 184 GSMFFREIN-YSGLVNLLNCEGQYLFADRTEDSVYPSVCQTG 224