BLASTX nr result
ID: Zingiber24_contig00046627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046627 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002463421.1| hypothetical protein SORBIDRAFT_02g043560 [S... 59 7e-07 gb|EMS51042.1| hypothetical protein TRIUR3_14501 [Triticum urartu] 57 3e-06 tpg|DAA41806.1| TPA: hypothetical protein ZEAMMB73_575965 [Zea m... 57 3e-06 gb|EMT18335.1| hypothetical protein F775_01065 [Aegilops tauschii] 55 1e-05 >ref|XP_002463421.1| hypothetical protein SORBIDRAFT_02g043560 [Sorghum bicolor] gi|241926798|gb|EER99942.1| hypothetical protein SORBIDRAFT_02g043560 [Sorghum bicolor] Length = 806 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = +1 Query: 82 VGIPLIVKEVSCIETIRLYAELSLQLEALVGELEDTSVAIISQARGDFSFSNLGRAS 252 VG+P +V+E+ I+TIRLYAE +LQLEALVG LED + +I+ QA F+ S++ R S Sbjct: 97 VGLPALVREIQRIDTIRLYAEATLQLEALVGNLEDVAFSIVRQA-PKFNLSSILRKS 152 >gb|EMS51042.1| hypothetical protein TRIUR3_14501 [Triticum urartu] Length = 781 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/60 (53%), Positives = 41/60 (68%) Frame = +1 Query: 82 VGIPLIVKEVSCIETIRLYAELSLQLEALVGELEDTSVAIISQARGDFSFSNLGRASTPI 261 V +P IV+E+ I+TIRLYAE +LQLEALVG LED + +I+ QA S L RAS + Sbjct: 51 VELPAIVREIQRIDTIRLYAEATLQLEALVGNLEDAAYSIVRQASKLNLSSVLRRASNGV 110 >tpg|DAA41806.1| TPA: hypothetical protein ZEAMMB73_575965 [Zea mays] Length = 801 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 82 VGIPLIVKEVSCIETIRLYAELSLQLEALVGELEDTSVAIISQA 213 VG+P +V+E+ I+TIRLYAE +LQLE+LVG LED + +I+ QA Sbjct: 92 VGLPALVREIQRIDTIRLYAEATLQLESLVGNLEDAAFSIVRQA 135 >gb|EMT18335.1| hypothetical protein F775_01065 [Aegilops tauschii] Length = 928 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = +1 Query: 82 VGIPLIVKEVSCIETIRLYAELSLQLEALVGELEDTSVAIISQARGDFSFSNLGRASTPI 261 V +P IV+E+ I+TIRLYAE +LQLEALVG LED + +I+ A S L RAS + Sbjct: 198 VELPAIVREIQRIDTIRLYAEATLQLEALVGNLEDAAYSIVRPASKLNLSSVLRRASNGV 257 Query: 262 LQ 267 Q Sbjct: 258 EQ 259