BLASTX nr result
ID: Zingiber24_contig00046592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046592 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Mor... 72 1e-10 ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 8e-10 ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 8e-10 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 8e-10 gb|EOY06485.1| Mitochondrial substrate carrier family protein [T... 68 1e-09 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 68 1e-09 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 67 2e-09 ref|XP_004508276.1| PREDICTED: mitochondrial thiamine pyrophosph... 67 2e-09 gb|ESW26260.1| hypothetical protein PHAVU_003G104200g [Phaseolus... 67 3e-09 ref|XP_006280770.1| hypothetical protein CARUB_v10026741mg [Caps... 67 3e-09 gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus pe... 67 3e-09 ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 4e-09 ref|XP_002865695.1| mitochondrial substrate carrier family prote... 66 4e-09 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 66 5e-09 ref|XP_004173236.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 5e-09 ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 5e-09 ref|XP_002330367.1| predicted protein [Populus trichocarpa] 66 5e-09 ref|XP_002336856.1| predicted protein [Populus trichocarpa] 66 5e-09 ref|XP_003609662.1| Mitochondrial thiamine pyrophosphate carrier... 65 7e-09 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 65 1e-08 >gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Morus notabilis] Length = 331 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 MEDSGQLKRA++D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 1 MEDSGQLKRAVIDTTAGAIAGGISRTVTSPLDVIKIRFQ 39 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/39 (79%), Positives = 39/39 (100%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME++GQLKRAL+D++AGA++GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEETGQLKRALIDATAGAVSGGISRTVTSPLDVIKIRFQ 39 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME++GQLKRA +D+SAGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEETGQLKRAFIDASAGAISGGISRTVTSPLDVIKIRFQ 39 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME++GQLKRA +D+SAGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEETGQLKRAFIDASAGAISGGISRTVTSPLDVIKIRFQ 39 >gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRAL+D++AGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPGQLKRALIDATAGAISGGISRTVTSPLDVIKIRFQ 39 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRA +D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPGQLKRAFIDAAAGAIAGGISRTVTSPLDVIKIRFQ 39 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRA +D++AGAIAGGISRT+TSP+DVIKIRFQ Sbjct: 39 MEEPGQLKRAFIDATAGAIAGGISRTITSPLDVIKIRFQ 77 >ref|XP_004508276.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer arietinum] Length = 329 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ QLKRA++DSSAGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPSQLKRAIIDSSAGAISGGISRTVTSPLDVIKIRFQ 39 >gb|ESW26260.1| hypothetical protein PHAVU_003G104200g [Phaseolus vulgaris] Length = 331 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ +LKRAL+DSSAGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPSKLKRALIDSSAGAISGGISRTVTSPLDVIKIRFQ 39 >ref|XP_006280770.1| hypothetical protein CARUB_v10026741mg [Capsella rubella] gi|482549474|gb|EOA13668.1| hypothetical protein CARUB_v10026741mg [Capsella rubella] Length = 338 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 38/39 (97%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ++D GQ+KRAL+D+SAGA++GG+SRTVTSP+DVIKIRFQ Sbjct: 8 VDDPGQIKRALIDASAGAVSGGVSRTVTSPLDVIKIRFQ 46 >gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME++GQLKRA +D++AG IAGGISRTVTSP+DVIKIRFQ Sbjct: 1 MEETGQLKRAFIDATAGLIAGGISRTVTSPLDVIKIRFQ 39 >ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Fragaria vesca subsp. vesca] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRA++D++AG IAGGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPGQLKRAVIDATAGLIAGGISRTVTSPLDVIKIRFQ 39 >ref|XP_002865695.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297311530|gb|EFH41954.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 338 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 +ED GQ+KRAL+D+SAGAI+GG+SRT TSP+DVIKIRFQ Sbjct: 8 VEDPGQIKRALIDASAGAISGGVSRTFTSPLDVIKIRFQ 46 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 310 EDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 E GQLKRAL+D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 13 EAPGQLKRALIDATAGAIAGGISRTVTSPLDVIKIRFQ 50 >ref|XP_004173236.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like, partial [Cucumis sativus] Length = 120 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRA++DS+AGAIAG +SRTVTSP+DVIKIRFQ Sbjct: 6 MEEPGQLKRAMIDSTAGAIAGCVSRTVTSPLDVIKIRFQ 44 >ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cucumis sativus] Length = 340 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ GQLKRA++DS+AGAIAG +SRTVTSP+DVIKIRFQ Sbjct: 6 MEEPGQLKRAMIDSTAGAIAGCVSRTVTSPLDVIKIRFQ 44 >ref|XP_002330367.1| predicted protein [Populus trichocarpa] Length = 329 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 310 EDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 E GQLKRAL+D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 1 EAPGQLKRALIDATAGAIAGGISRTVTSPLDVIKIRFQ 38 >ref|XP_002336856.1| predicted protein [Populus trichocarpa] Length = 67 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 310 EDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 E GQLKRAL+D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 11 EAPGQLKRALIDATAGAIAGGISRTVTSPLDVIKIRFQ 48 >ref|XP_003609662.1| Mitochondrial thiamine pyrophosphate carrier [Medicago truncatula] gi|355510717|gb|AES91859.1| Mitochondrial thiamine pyrophosphate carrier [Medicago truncatula] Length = 224 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 307 MEDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 ME+ QL RA++DSSAGAI+GGISRTVTSP+DVIKIRFQ Sbjct: 1 MEEPSQLNRAIIDSSAGAISGGISRTVTSPLDVIKIRFQ 39 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +1 Query: 310 EDSGQLKRALVDSSAGAIAGGISRTVTSPMDVIKIRFQ 423 + GQ+KRAL+D++AGAIAGGISRTVTSP+DVIKIRFQ Sbjct: 12 DGGGQIKRALIDATAGAIAGGISRTVTSPLDVIKIRFQ 49