BLASTX nr result
ID: Zingiber24_contig00046340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046340 (473 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACG43013.1| eukaryotic translation initiation factor 3 subuni... 50 2e-07 >gb|ACG43013.1| eukaryotic translation initiation factor 3 subunit 12 [Zea mays] gi|223943573|gb|ACN25870.1| unknown [Zea mays] gi|414865165|tpg|DAA43722.1| TPA: eukaryotic translation initiation factor 3 subunit 12 [Zea mays] Length = 226 Score = 50.1 bits (118), Expect(2) = 2e-07 Identities = 35/86 (40%), Positives = 41/86 (47%), Gaps = 20/86 (23%) Frame = -3 Query: 252 SQPVNASTTMTCLELC---PGS*HLHRKVLGGEQALMAMSTPDFSLCLFLIP-------- 106 SQ N ++ L L PG +H +ALMAM PDFSLCLFLIP Sbjct: 39 SQTYNLDANLSLLRLYQFEPGRMSIHIVAHILIKALMAMPAPDFSLCLFLIPEHVQMEEQ 98 Query: 105 ---------V*EAARFRQFWNEAAKN 55 E ARFRQFW++AA N Sbjct: 99 FKALIVLSHYLETARFRQFWDDAANN 124 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 361 YNPDTLTELENYVNEQV 311 YNPD L +LE +VNEQV Sbjct: 21 YNPDILNDLEKFVNEQV 37