BLASTX nr result
ID: Zingiber24_contig00046319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046319 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|2099541... 87 2e-15 ref|YP_588408.1| ATPase subunit 1 [Zea mays subsp. mays] gi|9450... 87 3e-15 ref|YP_762487.1| ATPase subunit 1 [Tripsacum dactyloides] gi|114... 87 3e-15 ref|YP_762500.1| ATPase subunit 1 [Tripsacum dactyloides] gi|114... 87 3e-15 ref|YP_514682.1| ATP synthase F0 subunit 1 [Oryza sativa Indica ... 86 5e-15 ref|YP_398393.1| atp1 [Triticum aestivum] gi|556927028|ref|YP_00... 86 5e-15 sp|P12862.1|ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha... 86 5e-15 ref|XP_004987299.1| PREDICTED: ATP synthase subunit alpha, mitoc... 86 5e-15 gb|AGI48792.1| ATP synthase subunits 1 (mitochondrion) [Lolium p... 86 5e-15 dbj|BAD38497.1| ATP synthase F0 subunit 1 [Oryza sativa Japonica... 86 5e-15 gb|AEK66750.1| ATPase subunit 1 [Ferrocalamus rimosivaginus] gi|... 86 5e-15 ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [P... 86 5e-15 gb|ADA85892.1| unknown [Allium cepa] 86 5e-15 gb|ADA85891.1| ATPase alpha subunit (mitochondrion) [Allium cepa] 86 5e-15 gb|ADA85889.1| ATPase alpha subunit (mitochondrion) [Allium cepa] 86 5e-15 gb|ABY55213.1| Atp1 [Bambusa oldhamii] 86 5e-15 gb|ABY83982.1| atp1 [Secale strictum] 86 5e-15 ref|YP_762326.1| ATPase subunit 1 [Sorghum bicolor] gi|114309647... 86 5e-15 ref|YP_002000594.1| ATP synthase F0 subunit 1 [Oryza sativa Japo... 86 5e-15 gb|AFZ85288.1| ATP synthase subunit 1, partial (mitochondrion) [... 85 9e-15 >ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|209954192|emb|CAQ77653.1| ATPase subunit 1 [Vitis vinifera] gi|239764719|gb|ACS15190.1| ATPase subunit 1 [Vitis vinifera] Length = 509 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESR+TNF T+LKVDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRITNFYTNLKVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_588408.1| ATPase subunit 1 [Zea mays subsp. mays] gi|94502566|ref|YP_588421.1| ATPase subunit 1 [Zea mays subsp. mays] gi|114151558|ref|YP_740361.1| ATPase subunit 1 [Zea perennis] gi|114151591|ref|YP_740440.1| ATPase subunit 1 [Zea luxurians] gi|114151624|ref|YP_740394.1| ATPase subunit 1 [Zea mays subsp. parviglumis] gi|114405|sp|P05494.1|ATPAM_MAIZE RecName: Full=ATP synthase subunit alpha, mitochondrial gi|13901|emb|CAA77319.1| unnamed protein product [Zea mays] gi|897619|gb|AAA70269.1| F1-ATPase alpha subunit [Zea mays] gi|40795004|gb|AAR91048.1| ATPase subunit 1 (mitochondrion) [Zea mays] gi|40795005|gb|AAR91049.1| ATPase subunit 1 (mitochondrion) [Zea mays] gi|93116034|gb|ABE98667.1| ATPase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|93116078|gb|ABE98710.1| ATPase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|93116123|gb|ABE98754.1| ATPase subunit 1 [Zea mays subsp. mays] gi|102567892|gb|ABF70809.1| ATPase subunit 1 (mitochondrion) [Zea perennis] gi|102567957|gb|ABF70841.1| ATPase subunit 1 (mitochondrion) [Zea mays subsp. parviglumis] gi|102579627|gb|ABF70907.1| ATPase subunit 1 (mitochondrion) [Zea mays subsp. mays] gi|110287587|gb|ABG65633.1| ATPase subunit 1 (mitochondrion) [Zea luxurians] gi|224968|prf||1204280A ATPase alpha,F1 Length = 508 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRM NF T+LKVDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMINFYTNLKVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_762487.1| ATPase subunit 1 [Tripsacum dactyloides] gi|114432086|gb|ABI74635.1| ATPase subunit 1 (mitochondrion) [Tripsacum dactyloides] Length = 508 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRM NF T+LKVDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMINFYTNLKVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_762500.1| ATPase subunit 1 [Tripsacum dactyloides] gi|114432087|gb|ABI74636.1| ATPase subunit 1 (mitochondrion) [Tripsacum dactyloides] Length = 816 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRM NF T+LKVDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMINFYTNLKVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_514682.1| ATP synthase F0 subunit 1 [Oryza sativa Indica Group] gi|289065052|ref|YP_003433863.1| ATP synthase F0 subunit 1 [Oryza rufipogon] gi|13959|emb|CAA35787.1| unnamed protein product [Oryza sativa Japonica Group] gi|74100078|gb|AAZ99242.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|74100133|gb|AAZ99296.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Japonica Group] gi|74100187|gb|AAZ99349.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Japonica Group] gi|285026134|dbj|BAI67967.1| ATP synthase F0 subunit 1 [Oryza rufipogon] gi|285026184|dbj|BAI68016.1| ATP synthase F0 subunit 1 [Oryza sativa Indica Group] gi|285026197|dbj|BAI68029.1| ATP synthase F0 subunit 1 [Oryza sativa Indica Group] gi|353685220|gb|AER12983.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685221|gb|AER12984.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685289|gb|AER13051.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|353685290|gb|AER13052.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|374277605|gb|AEZ03711.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] gi|374277707|gb|AEZ03812.1| ATP synthase F0 subunit 1 (mitochondrion) [Oryza sativa Indica Group] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_398393.1| atp1 [Triticum aestivum] gi|556927028|ref|YP_008757384.1| ATP synthase subunit 1 (mitochondrion) [Aegilops speltoides] gi|556927187|ref|YP_008758145.1| ATP synthase subunit 1 (mitochondrion) [Triticum timopheevii] gi|13725|emb|CAA34060.1| unnamed protein product [Triticum aestivum] gi|1405781|emb|CAA56641.1| ATP synthase subunit alpha [Triticum durum x Triticosecale sp.] gi|1430900|emb|CAA67492.1| atpA [Secale cereale] gi|78675233|dbj|BAE47658.1| atp1 [Triticum aestivum] gi|169649046|gb|ACA62607.1| apt1 [Triticum aestivum] gi|291498595|gb|ADE08069.1| apt1-1 [Triticum aestivum] gi|291498596|gb|ADE08070.1| apt1-2 [Triticum aestivum] gi|549067734|dbj|BAN94706.1| ATP synthase subunit 1 (mitochondrion) [Triticum timopheevii] gi|549067792|dbj|BAN94763.1| ATP synthase subunit 1 (mitochondrion) [Aegilops speltoides] gi|578888235|gb|AHI16340.1| atp1 (mitochondrion) [Aegilops longissima] gi|578888257|gb|AHI16361.1| atp1 (mitochondrion) [Triticum durum] gi|578888290|gb|AHI16393.1| atp1 (mitochondrion) [Triticum durum] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >sp|P12862.1|ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha, mitochondrial Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >ref|XP_004987299.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Setaria italica] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|AGI48792.1| ATP synthase subunits 1 (mitochondrion) [Lolium perenne] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >dbj|BAD38497.1| ATP synthase F0 subunit 1 [Oryza sativa Japonica Group] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|AEK66750.1| ATPase subunit 1 [Ferrocalamus rimosivaginus] gi|372861939|gb|AEX98090.1| ATPase subunit 1 (mitochondrion) [Ferrocalamus rimosivaginus] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] gi|343478430|gb|AEM43918.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|ADA85892.1| unknown [Allium cepa] Length = 435 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|ADA85891.1| ATPase alpha subunit (mitochondrion) [Allium cepa] Length = 506 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|ADA85889.1| ATPase alpha subunit (mitochondrion) [Allium cepa] Length = 507 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|ABY55213.1| Atp1 [Bambusa oldhamii] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|ABY83982.1| atp1 [Secale strictum] Length = 495 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_762326.1| ATPase subunit 1 [Sorghum bicolor] gi|114309647|gb|ABI60864.1| ATPase subunit 1 (mitochondrion) [Sorghum bicolor] Length = 513 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >ref|YP_002000594.1| ATP synthase F0 subunit 1 [Oryza sativa Japonica Group] gi|148886790|sp|P0C520.1|ATPAM_ORYSA RecName: Full=ATP synthase subunit alpha, mitochondrial gi|148886791|sp|P0C521.1|ATPAM_ORYSI RecName: Full=ATP synthase subunit alpha, mitochondrial gi|148886792|sp|P0C522.1|ATPAM_ORYSJ RecName: Full=ATP synthase subunit alpha, mitochondrial gi|60498752|dbj|BAC19899.2| ATP synthase F0 subunit 1 [Oryza sativa Japonica Group] Length = 509 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 142 MEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 MEFSPRAAELTTLLESRMTNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 1 MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLN 47 >gb|AFZ85288.1| ATP synthase subunit 1, partial (mitochondrion) [Gossypium hirsutum] gi|429465365|gb|AFZ85289.1| ATP synthase subunit 1, partial (mitochondrion) [Gossypium hirsutum] gi|429465368|gb|AFZ85290.1| ATP synthase subunit 1, partial (mitochondrion) [Gossypium hirsutum] Length = 500 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 148 LSMEFSPRAAELTTLLESRMTNFDTHLKVDEIGRVVSVGDGIARVYGLN 2 L MEFSPRAAELTTLLESR+TNF T+ +VDEIGRVVSVGDGIARVYGLN Sbjct: 3 LFMEFSPRAAELTTLLESRITNFYTNFQVDEIGRVVSVGDGIARVYGLN 51