BLASTX nr result
ID: Zingiber24_contig00046266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046266 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532200.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002532200.1| conserved hypothetical protein [Ricinus communis] gi|223528096|gb|EEF30169.1| conserved hypothetical protein [Ricinus communis] Length = 161 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/79 (37%), Positives = 43/79 (54%) Frame = +2 Query: 68 VVDFAFNSMAGKLEKMXXXXXXXXXXXXDDARCIVEELRSITSFLMAMSKRRNLDDQLQN 247 + D A N + K+ + DD I EL SITSFL +R+ + + ++ Sbjct: 1 MADGAMNFLLDKITTILLQKASLLGDASDDIEEIKLELESITSFLRDAERRKEMSESVET 60 Query: 248 WVQEVREVAYDAEDSIDEF 304 WV++VREVAY+AED I EF Sbjct: 61 WVRQVREVAYEAEDIIYEF 79