BLASTX nr result
ID: Zingiber24_contig00046027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00046027 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBM42564.1| putative B-type response regulator 22 [Populus x... 80 2e-13 ref|XP_006483454.1| PREDICTED: two-component response regulator ... 79 5e-13 ref|XP_006483453.1| PREDICTED: two-component response regulator ... 79 5e-13 ref|XP_006450309.1| hypothetical protein CICLE_v10007639mg [Citr... 79 5e-13 ref|XP_006450308.1| hypothetical protein CICLE_v10007639mg [Citr... 79 5e-13 ref|XP_006371760.1| hypothetical protein POPTR_0018s02330g [Popu... 79 6e-13 gb|EOY29369.1| Type-b response regulator, putative [Theobroma ca... 79 6e-13 ref|XP_002515447.1| two-component system sensor histidine kinase... 79 6e-13 ref|XP_002324320.1| Two-component response regulator ARR10 famil... 79 6e-13 gb|EPS66651.1| hypothetical protein M569_08125, partial [Genlise... 78 1e-12 ref|XP_004954220.1| PREDICTED: two-component response regulator ... 78 1e-12 gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [... 78 1e-12 gb|EXB38648.1| Two-component response regulator [Morus notabilis] 78 1e-12 ref|XP_002308698.2| hypothetical protein POPTR_0006s27800g [Popu... 77 2e-12 ref|XP_004951672.1| PREDICTED: two-component response regulator ... 77 2e-12 gb|EMS59871.1| Two-component response regulator ARR12 [Triticum ... 77 2e-12 ref|XP_002453411.1| hypothetical protein SORBIDRAFT_04g005580 [S... 77 2e-12 ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 77 2e-12 ref|XP_004145510.1| PREDICTED: two-component response regulator ... 77 2e-12 gb|EMT11380.1| Two-component response regulator ARR12 [Aegilops ... 77 3e-12 >emb|CBM42564.1| putative B-type response regulator 22 [Populus x canadensis] Length = 668 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWSM+LHRKFVAAVNQ+G+DKAVPK+IL+LMNVEK Sbjct: 197 TTQKKPRVVWSMELHRKFVAAVNQLGVDKAVPKKILDLMNVEK 239 >ref|XP_006483454.1| PREDICTED: two-component response regulator ARR12-like isoform X2 [Citrus sinensis] Length = 654 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 237 >ref|XP_006483453.1| PREDICTED: two-component response regulator ARR12-like isoform X1 [Citrus sinensis] Length = 663 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 237 >ref|XP_006450309.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] gi|557553535|gb|ESR63549.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] Length = 663 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 237 >ref|XP_006450308.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] gi|557553534|gb|ESR63548.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] Length = 695 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 237 >ref|XP_006371760.1| hypothetical protein POPTR_0018s02330g [Populus trichocarpa] gi|550317865|gb|ERP49557.1| hypothetical protein POPTR_0018s02330g [Populus trichocarpa] Length = 667 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+G+DKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGVDKAVPKKILDLMNVEK 237 >gb|EOY29369.1| Type-b response regulator, putative [Theobroma cacao] Length = 625 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 +TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+ILELMNVEK Sbjct: 198 STQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILELMNVEK 240 >ref|XP_002515447.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223545391|gb|EEF46896.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Length = 663 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+G+DKAVPK+IL+LMNVEK Sbjct: 192 TTQKKPRVVWSVELHRKFVAAVNQLGVDKAVPKKILDLMNVEK 234 >ref|XP_002324320.1| Two-component response regulator ARR10 family protein [Populus trichocarpa] gi|222865754|gb|EEF02885.1| Two-component response regulator ARR10 family protein [Populus trichocarpa] Length = 661 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TTQKK RVVWS++LHRKFVAAVNQ+G+DKAVPK+IL+LMNVEK Sbjct: 195 TTQKKPRVVWSVELHRKFVAAVNQLGVDKAVPKKILDLMNVEK 237 >gb|EPS66651.1| hypothetical protein M569_08125, partial [Genlisea aurea] Length = 317 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVE 5 +TQKK RVVW MDLHRKFVAAVNQ+GIDKAVPKRIL+LMNVE Sbjct: 186 STQKKPRVVWCMDLHRKFVAAVNQLGIDKAVPKRILDLMNVE 227 >ref|XP_004954220.1| PREDICTED: two-component response regulator ARR12-like [Setaria italica] Length = 679 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 S+T KK RVVWS++LHRKFVAAVNQ+GIDKAVPKRILELMNV+K Sbjct: 207 SSTPKKPRVVWSVELHRKFVAAVNQLGIDKAVPKRILELMNVDK 250 >gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [Prunus persica] Length = 659 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 +TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 201 STQKKPRVVWSLELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 243 >gb|EXB38648.1| Two-component response regulator [Morus notabilis] Length = 674 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 130 TTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 +TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 202 STQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 244 >ref|XP_002308698.2| hypothetical protein POPTR_0006s27800g [Populus trichocarpa] gi|550337222|gb|EEE92221.2| hypothetical protein POPTR_0006s27800g [Populus trichocarpa] Length = 682 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -3 Query: 127 TQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 194 TQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVEK 235 >ref|XP_004951672.1| PREDICTED: two-component response regulator ARR10-like isoform X1 [Setaria italica] gi|514708982|ref|XP_004951673.1| PREDICTED: two-component response regulator ARR10-like isoform X2 [Setaria italica] Length = 634 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVE 5 S+TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVE Sbjct: 205 SSTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVE 247 >gb|EMS59871.1| Two-component response regulator ARR12 [Triticum urartu] Length = 609 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 S KK RVVWS++LHRKFVAAVNQ+GIDKAVPKRILELMNVEK Sbjct: 198 SAASKKPRVVWSVELHRKFVAAVNQLGIDKAVPKRILELMNVEK 241 >ref|XP_002453411.1| hypothetical protein SORBIDRAFT_04g005580 [Sorghum bicolor] gi|241933242|gb|EES06387.1| hypothetical protein SORBIDRAFT_04g005580 [Sorghum bicolor] Length = 631 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVE 5 S+TQKK RVVWS++LHRKFVAAVNQ+GIDKAVPK+IL+LMNVE Sbjct: 208 SSTQKKPRVVWSVELHRKFVAAVNQLGIDKAVPKKILDLMNVE 250 >ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 S+TQKK RVVWS++LHRKFV AVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 192 SSTQKKPRVVWSVELHRKFVNAVNQLGIDKAVPKKILDLMNVEK 235 >ref|XP_004145510.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 S+TQKK RVVWS++LHRKFV AVNQ+GIDKAVPK+IL+LMNVEK Sbjct: 192 SSTQKKPRVVWSVELHRKFVNAVNQLGIDKAVPKKILDLMNVEK 235 >gb|EMT11380.1| Two-component response regulator ARR12 [Aegilops tauschii] Length = 651 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -3 Query: 133 STTQKKQRVVWSMDLHRKFVAAVNQMGIDKAVPKRILELMNVEK 2 S KK RVVWS +LHRKFVAAVNQ+GIDKAVPKRILELMNVEK Sbjct: 210 SAASKKPRVVWSAELHRKFVAAVNQLGIDKAVPKRILELMNVEK 253