BLASTX nr result
ID: Zingiber24_contig00045606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00045606 (816 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW24939.1| hypothetical protein PHAVU_004G173600g [Phaseolus... 57 8e-06 >gb|ESW24939.1| hypothetical protein PHAVU_004G173600g [Phaseolus vulgaris] Length = 354 Score = 57.0 bits (136), Expect = 8e-06 Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Frame = -1 Query: 816 CKDGAACLRRVCFFAHSPEQLRVVLPSSPRSPGKC-GGAVMXXXXXXXXXXXTMXXXXXX 640 CKDG +C RRVCFFAH+PEQLR+V SPRS G+ G+ M + Sbjct: 165 CKDGTSCRRRVCFFAHTPEQLRLVPMQSPRSSGESYDGSPMRQILQSTAFMSSPAASLSP 224 Query: 639 XXXXXXPVAVEDVVAVMSKLRLSEMRSSMPFGTRTVEAG 523 ++ ++VA + L+L +M+ SMP R V G Sbjct: 225 PESPPLSPSMNEMVASLRNLQLGKMK-SMPH-NRNVSVG 261