BLASTX nr result
ID: Zingiber24_contig00045523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00045523 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006397838.1| hypothetical protein EUTSA_v10001727mg [Eutr... 57 2e-06 >ref|XP_006397838.1| hypothetical protein EUTSA_v10001727mg [Eutrema salsugineum] gi|557098911|gb|ESQ39291.1| hypothetical protein EUTSA_v10001727mg [Eutrema salsugineum] Length = 429 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 6/81 (7%) Frame = -1 Query: 301 VRKFLKLPDL----ASQPAPAAQPDFSTFGGSKPMAPTA--PPLPAKESEQSNTPGKRLS 140 VRK L LPD+ QP+PA+ FS F K + PP+P+ ES S+ PG+R+S Sbjct: 348 VRKLLNLPDVIISSTRQPSPASPMPFS-FTQPKDQSDVQENPPMPSSESSSSSAPGRRIS 406 Query: 139 TSTLISLRIRSLEKAMKARNR 77 S++++ RIR+LE+ +K R + Sbjct: 407 RSSVLNQRIRTLERQLKDRKK 427