BLASTX nr result
ID: Zingiber24_contig00045436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00045436 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470224.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-... 57 3e-06 ref|XP_006446623.1| hypothetical protein CICLE_v10015565mg [Citr... 57 3e-06 >ref|XP_006470224.1| PREDICTED: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like isoform X2 [Citrus sinensis] Length = 386 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 96 GYYSCKKKDHICEDVCGETSRVALTMSRLRC 4 GYYS KK D ICEDVCG+ SRV LTMSRLRC Sbjct: 4 GYYSSKKTDDICEDVCGQASRVGLTMSRLRC 34 >ref|XP_006446623.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] gi|567908621|ref|XP_006446624.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] gi|567908623|ref|XP_006446625.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] gi|557549234|gb|ESR59863.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] gi|557549235|gb|ESR59864.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] gi|557549236|gb|ESR59865.1| hypothetical protein CICLE_v10015565mg [Citrus clementina] Length = 386 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 96 GYYSCKKKDHICEDVCGETSRVALTMSRLRC 4 GYYS KK D ICEDVCG+ SRV LTMSRLRC Sbjct: 4 GYYSSKKTDDICEDVCGQASRVGLTMSRLRC 34