BLASTX nr result
ID: Zingiber24_contig00045169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00045169 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU81604.1| putative serine/threonine receptor protein kinase... 100 3e-19 gb|EXC36488.1| L-type lectin-domain containing receptor kinase I... 89 8e-16 gb|ABY59531.1| protein kinase-like resistance protein [Musa acum... 89 8e-16 gb|ABX56569.1| protein kinase-like resistance protein [Musa acum... 89 8e-16 gb|ABX56566.1| protein kinase-like resistance protein [Musa acum... 89 8e-16 ref|XP_003579172.1| PREDICTED: L-type lectin-domain containing r... 87 2e-15 gb|ABY59527.1| protein kinase-like resistance protein [Musa acum... 87 3e-15 gb|EMT26261.1| Putative LRR receptor-like serine/threonine-prote... 59 5e-15 gb|AAT94934.1| receptor-type protein kinase LRK [Mangifera indica] 86 5e-15 dbj|BAJ85196.1| predicted protein [Hordeum vulgare subsp. vulgare] 85 9e-15 gb|EOX91873.1| Concanavalin A-like lectin protein kinase family ... 85 1e-14 ref|XP_003567178.1| PREDICTED: L-type lectin-domain containing r... 85 1e-14 gb|EMT05205.1| Lectin-domain containing receptor kinase A4.3 [Ae... 84 2e-14 gb|EMS59072.1| L-type lectin-domain containing receptor kinase I... 84 2e-14 gb|EMS45957.1| L-type lectin-domain containing receptor kinase I... 84 2e-14 ref|XP_003576432.1| PREDICTED: L-type lectin-domain containing r... 84 2e-14 ref|XP_003562911.1| PREDICTED: L-type lectin-domain containing r... 84 2e-14 dbj|BAK02100.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 2e-14 ref|XP_002527233.1| kinase, putative [Ricinus communis] gi|22353... 84 2e-14 ref|XP_002527232.1| kinase, putative [Ricinus communis] gi|22353... 84 2e-14 >gb|AAU81604.1| putative serine/threonine receptor protein kinase STK4 [Carica papaya] Length = 176 Score = 99.8 bits (247), Expect = 3e-19 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNG+L+SHLY S L WP RHK A+GLASALFYLH EC+P VVHRDVKPSN Sbjct: 59 LLVYEFMPNGNLNSHLYRSENPLGWPARHKIALGLASALFYLHEECEPYVVHRDVKPSN 117 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 173 AIGLASALFYLHHECDPGVVHRDVKPSNVML 265 A+GLASALFYLH EC+P VVHRDVKPSNVML Sbjct: 90 ALGLASALFYLHEECEPYVVHRDVKPSNVML 120 >gb|EXC36488.1| L-type lectin-domain containing receptor kinase IX.1 [Morus notabilis] Length = 683 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 +LVYEF+PNGSLD+HL+ K L+W RHK A+GLASAL YLH EC+ VVHRD+K SN Sbjct: 406 ILVYEFLPNGSLDTHLFGKRKVLKWAIRHKIALGLASALLYLHEECEKCVVHRDIKSSN 464 >gb|ABY59531.1| protein kinase-like resistance protein [Musa acuminata AAA Group] Length = 178 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/59 (71%), Positives = 46/59 (77%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDS+LY L WP RHK A+GLASAL YLH E + V+HRDVKPSN Sbjct: 61 LLVYEFMPNGSLDSYLYSPAAGLGWPARHKIALGLASALLYLHEEWEQCVMHRDVKPSN 119 >gb|ABX56569.1| protein kinase-like resistance protein [Musa acuminata] Length = 178 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/59 (71%), Positives = 46/59 (77%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDS+LY L WP RHK A+GLASAL YLH E + V+HRDVKPSN Sbjct: 61 LLVYEFMPNGSLDSYLYSPAAGLGWPARHKIALGLASALLYLHEEWEQCVMHRDVKPSN 119 >gb|ABX56566.1| protein kinase-like resistance protein [Musa acuminata] Length = 178 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/59 (71%), Positives = 46/59 (77%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDS+LY L WP RHK A+GLASAL YLH E + V+HRDVKPSN Sbjct: 61 LLVYEFMPNGSLDSYLYSPAAGLGWPARHKIALGLASALLYLHEEWEQCVMHRDVKPSN 119 >ref|XP_003579172.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.2-like [Brachypodium distachyon] Length = 693 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVY+ MPNGSLD+HLY S L WP RH+ IGL SAL YLHHE + V+HRD+KPSN Sbjct: 459 LLVYDLMPNGSLDTHLYGSNNTLSWPLRHEIVIGLGSALVYLHHEWEQCVLHRDIKPSN 517 >gb|ABY59527.1| protein kinase-like resistance protein [Musa acuminata AAA Group] Length = 174 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEF+PNGSLDS+LY L WP RHK A+GLASAL YLH E + V HRDVKPSN Sbjct: 61 LLVYEFIPNGSLDSYLYSPAAGLGWPARHKIALGLASALLYLHEEWEQCVTHRDVKPSN 119 >gb|EMT26261.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 1241 Score = 59.3 bits (142), Expect(2) = 5e-15 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = +1 Query: 4 LVYEFMPNGSLDSHLYC----STKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKP 171 LVYE + GSL LY S + WP R +A GLASAL YLHH+C P ++HRDV Sbjct: 920 LVYERVERGSLGKVLYMGGERSGERFDWPARMRAIRGLASALAYLHHDCSPPMIHRDVSV 979 Query: 172 SN 177 +N Sbjct: 980 NN 981 Score = 47.0 bits (110), Expect(2) = 5e-15 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +2 Query: 173 AIGLASALFYLHHECDPGVVHRDVKPSNVML 265 A GLASAL YLHH+C P ++HRDV +NV+L Sbjct: 998 ARGLASALAYLHHDCSPPMIHRDVSVNNVLL 1028 >gb|AAT94934.1| receptor-type protein kinase LRK [Mangifera indica] Length = 178 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDS+LY L WP RHK A+GLASAL Y H E + V+HRDVKPSN Sbjct: 61 LLVYEFMPNGSLDSYLYSPAAGLGWPARHKIALGLASALLYPHEEWEQCVMHRDVKPSN 119 >dbj|BAJ85196.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 708 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE MPNGSLD+HLY K L WP RH+ +GL+SAL YLH E + V+HRD+KPSN Sbjct: 427 LLVYELMPNGSLDTHLYGRNKVLPWPVRHEIVLGLSSALLYLHQEWEQCVLHRDIKPSN 485 >gb|EOX91873.1| Concanavalin A-like lectin protein kinase family protein [Theobroma cacao] Length = 666 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/59 (64%), Positives = 46/59 (77%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLD HL+ L WP R++ ++GLASA+FYLH EC+ VVHRD+K SN Sbjct: 427 LLVYEFMPNGSLDYHLFGQRIPLTWPVRYRISLGLASAIFYLHEECEQCVVHRDIKSSN 485 >ref|XP_003567178.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Brachypodium distachyon] Length = 615 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE MPNGS+D HLY L WPTR++ A+GLASA+ YLH EC +VHRD+KPSN Sbjct: 353 LLVYELMPNGSVDHHLYGKGVLLTWPTRYEIALGLASAMLYLHEECLQCIVHRDIKPSN 411 >gb|EMT05205.1| Lectin-domain containing receptor kinase A4.3 [Aegilops tauschii] Length = 677 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE MPNGS+D HLY L WPTR+ A+GLASAL YLH EC +VHRD+KPSN Sbjct: 413 LLVYELMPNGSVDQHLYGKGVHLTWPTRYDIALGLASALLYLHEECLQCIVHRDIKPSN 471 >gb|EMS59072.1| L-type lectin-domain containing receptor kinase IX.1 [Triticum urartu] Length = 681 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE M NGSLD HLY ST L WPTR+K +G SAL YLH E + VVHRD+KPSN Sbjct: 434 LLVYELMTNGSLDEHLYSSTNILTWPTRYKIILGTGSALLYLHQEWEQCVVHRDIKPSN 492 >gb|EMS45957.1| L-type lectin-domain containing receptor kinase IX.1 [Triticum urartu] Length = 664 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE MPNGS+D HLY L WPTR+ A+GLASAL YLH EC +VHRD+KPSN Sbjct: 400 LLVYELMPNGSVDQHLYGKGVHLTWPTRYDIALGLASALLYLHEECLQCIVHRDIKPSN 458 >ref|XP_003576432.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Brachypodium distachyon] Length = 716 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE M N SLD HLY S + L WPTR+K +G+ SALFYLH EC+ V+HRD+KPSN Sbjct: 422 LLVYELMENRSLDVHLYNSKQVLAWPTRYKIILGMGSALFYLHQECEQCVLHRDIKPSN 480 >ref|XP_003562911.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Brachypodium distachyon] Length = 690 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/59 (67%), Positives = 45/59 (76%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPN SLD+HLY ++ L WP R K IG+ASAL YLH E + VVHRDVKPSN Sbjct: 419 LLVYEFMPNRSLDTHLYDNSNLLTWPLRFKVTIGVASALLYLHEEWEQCVVHRDVKPSN 477 >dbj|BAK02100.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 671 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYE MPNGS+D HLY L WPTR+ A+GLASAL YLH EC +VHRD+KPSN Sbjct: 411 LLVYELMPNGSVDQHLYGKGVHLTWPTRYDIALGLASALLYLHEECLQCIVHRDIKPSN 469 >ref|XP_002527233.1| kinase, putative [Ricinus communis] gi|223533409|gb|EEF35159.1| kinase, putative [Ricinus communis] Length = 652 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/59 (67%), Positives = 44/59 (74%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDSHL+ L W RHK ++GLASAL YLH E + VVHRDVK SN Sbjct: 413 LLVYEFMPNGSLDSHLFGKKSSLTWAVRHKISLGLASALLYLHEEWEQCVVHRDVKSSN 471 >ref|XP_002527232.1| kinase, putative [Ricinus communis] gi|223533408|gb|EEF35158.1| kinase, putative [Ricinus communis] Length = 584 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/59 (67%), Positives = 43/59 (72%) Frame = +1 Query: 1 LLVYEFMPNGSLDSHLYCSTKCLRWPTRHKAAIGLASALFYLHHECDPGVVHRDVKPSN 177 LLVYEFMPNGSLDSHL+ L W RHK +GLASAL YLH E + VVHRDVK SN Sbjct: 343 LLVYEFMPNGSLDSHLFSKKNSLTWAIRHKIVLGLASALLYLHEEWEQCVVHRDVKSSN 401