BLASTX nr result
ID: Zingiber24_contig00045133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00045133 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16226.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002284657.1| PREDICTED: DNA-directed RNA polymerase III s... 56 6e-06 >emb|CBI16226.3| unnamed protein product [Vitis vinifera] Length = 1819 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/63 (55%), Positives = 39/63 (61%), Gaps = 3/63 (4%) Frame = +1 Query: 208 LSVTWIGNHDFSIGIDDVHPGQHLN*QKTKKS*WI*RTL*PYFIIQQRN---LTLLPGCN 378 LS WIGNH FSIGIDDV PG LN QK+K+ + +IQQ N L L PGCN Sbjct: 683 LSARWIGNHGFSIGIDDVQPGGLLNDQKSKRIEEGYENC--HELIQQYNKGKLKLQPGCN 740 Query: 379 AAQ 387 AAQ Sbjct: 741 AAQ 743 >ref|XP_002284657.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like [Vitis vinifera] Length = 1383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/63 (55%), Positives = 39/63 (61%), Gaps = 3/63 (4%) Frame = +1 Query: 208 LSVTWIGNHDFSIGIDDVHPGQHLN*QKTKKS*WI*RTL*PYFIIQQRN---LTLLPGCN 378 LS WIGNH FSIGIDDV PG LN QK+K+ + +IQQ N L L PGCN Sbjct: 683 LSARWIGNHGFSIGIDDVQPGGLLNDQKSKRIEEGYENC--HELIQQYNKGKLKLQPGCN 740 Query: 379 AAQ 387 AAQ Sbjct: 741 AAQ 743