BLASTX nr result
ID: Zingiber24_contig00044957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044957 (213 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001143273.1| hypothetical protein [Zea mays] gi|195616864... 60 3e-07 >ref|NP_001143273.1| hypothetical protein [Zea mays] gi|195616864|gb|ACG30262.1| hypothetical protein [Zea mays] gi|195616960|gb|ACG30310.1| hypothetical protein [Zea mays] gi|413925630|gb|AFW65562.1| hypothetical protein ZEAMMB73_733279 [Zea mays] Length = 282 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 39 QGEVDTTRPFRSVKEAVAVFGERLLTGDASSSHKVTASSKVDTP 170 +GEVDT RPFRSVKEAVAVFG R+L G+ SSH TA++ + +P Sbjct: 7 RGEVDTARPFRSVKEAVAVFGHRILVGNNHSSHSSTAAAAIASP 50