BLASTX nr result
ID: Zingiber24_contig00044927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044927 (705 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_002977518.1| hypothetical protein SELMODRAFT_107192 [Sela... 107 3e-21 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 107 5e-21 ref|NP_193101.2| pentatricopeptide repeat-containing protein [Ar... 107 5e-21 gb|AEB39775.1| pentatricopeptide repeat protein 71 [Funaria hygr... 107 5e-21 emb|CAB36829.1| putative protein [Arabidopsis thaliana] gi|72680... 107 5e-21 gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus pe... 106 6e-21 ref|XP_004250798.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_002868345.1| pentatricopeptide repeat-containing protein ... 106 6e-21 gb|ESW18386.1| hypothetical protein PHAVU_006G036400g [Phaseolus... 106 8e-21 ref|XP_006282436.1| hypothetical protein CARUB_v10004043mg [Caps... 106 8e-21 ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containi... 106 8e-21 ref|XP_002975120.1| hypothetical protein SELMODRAFT_102603 [Sela... 106 8e-21 emb|CBI32403.3| unnamed protein product [Vitis vinifera] 106 8e-21 emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] 106 8e-21 ref|XP_006410248.1| hypothetical protein EUTSA_v10016243mg [Eutr... 105 1e-20 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_002978388.1| hypothetical protein SELMODRAFT_108652 [Sela... 105 1e-20 ref|XP_001761392.1| predicted protein [Physcomitrella patens] gi... 105 1e-20 gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily p... 105 2e-20 >ref|XP_004493379.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cicer arietinum] Length = 824 Score = 108 bits (270), Expect = 2e-21 Identities = 45/65 (69%), Positives = 55/65 (84%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFG++S P R PI +FKNLRVC DCH+ TK +S++T R+I+VRDSNRFHHF+ G CS Sbjct: 760 LAIAFGIISTPPRSPIRIFKNLRVCGDCHNATKYISRITERDIVVRDSNRFHHFKDGICS 819 Query: 523 CDDYW 509 CDDYW Sbjct: 820 CDDYW 824 >ref|XP_002977518.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii] gi|300154888|gb|EFJ21522.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii] Length = 652 Score = 107 bits (268), Expect = 3e-21 Identities = 45/65 (69%), Positives = 56/65 (86%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFGL+S P P+ + KNLRVC+DCH+ TK++SKVTGREI+VRD+NRFHHF+ G CS Sbjct: 588 LAIAFGLISTPPGAPLRIVKNLRVCSDCHAATKVISKVTGREILVRDTNRFHHFQNGMCS 647 Query: 523 CDDYW 509 C+DYW Sbjct: 648 CNDYW 652 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 107 bits (266), Expect = 5e-21 Identities = 45/65 (69%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFG++S P + PI +FKNLRVC DCH+ TK++S +T REIIVRDSNRFHHF+ G CS Sbjct: 803 LAIAFGIISTPPKTPIRIFKNLRVCGDCHTVTKLISVITEREIIVRDSNRFHHFKDGTCS 862 Query: 523 CDDYW 509 C DYW Sbjct: 863 CGDYW 867 >ref|NP_193101.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635639|sp|Q9SVP7.2|PP307_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g13650 gi|332657909|gb|AEE83309.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 1064 Score = 107 bits (266), Expect = 5e-21 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI+FGL+SLP PI V KNLRVCNDCH++ K VSKV+ REIIVRD+ RFHHF GG CS Sbjct: 1000 LAISFGLLSLPATVPINVMKNLRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACS 1059 Query: 523 CDDYW 509 C DYW Sbjct: 1060 CKDYW 1064 >gb|AEB39775.1| pentatricopeptide repeat protein 71 [Funaria hygrometrica] Length = 837 Score = 107 bits (266), Expect = 5e-21 Identities = 45/65 (69%), Positives = 55/65 (84%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIA+G++SLP+ PI +FKNLRVC DCHS +K +SKVTGREII RD++RFHHF+ G CS Sbjct: 773 LAIAYGVLSLPSGAPIRIFKNLRVCGDCHSASKFISKVTGREIIARDASRFHHFKNGVCS 832 Query: 523 CDDYW 509 C DYW Sbjct: 833 CGDYW 837 >emb|CAB36829.1| putative protein [Arabidopsis thaliana] gi|7268069|emb|CAB78407.1| putative protein [Arabidopsis thaliana] Length = 1024 Score = 107 bits (266), Expect = 5e-21 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI+FGL+SLP PI V KNLRVCNDCH++ K VSKV+ REIIVRD+ RFHHF GG CS Sbjct: 960 LAISFGLLSLPATVPINVMKNLRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACS 1019 Query: 523 CDDYW 509 C DYW Sbjct: 1020 CKDYW 1024 >gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] Length = 705 Score = 106 bits (265), Expect = 6e-21 Identities = 46/65 (70%), Positives = 53/65 (81%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFGL+S P + PI +FKNLRVC DCH+ TK +S +T REIIVRDSNRFHHF+ G CS Sbjct: 641 LAIAFGLISTPPKTPIRIFKNLRVCGDCHNATKFISVITEREIIVRDSNRFHHFKDGACS 700 Query: 523 CDDYW 509 C DYW Sbjct: 701 CGDYW 705 >ref|XP_004250798.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Solanum lycopersicum] Length = 911 Score = 106 bits (265), Expect = 6e-21 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIA+G++S P + P+ ++KNLRVC DCH+ TK++SK+T REIIVRDSNRFHHF+ G CS Sbjct: 847 LAIAYGILSTPPKSPLRIYKNLRVCGDCHNVTKLISKITEREIIVRDSNRFHHFKNGVCS 906 Query: 523 CDDYW 509 C DYW Sbjct: 907 CGDYW 911 >ref|XP_002868345.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297314181|gb|EFH44604.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1047 Score = 106 bits (265), Expect = 6e-21 Identities = 47/65 (72%), Positives = 52/65 (80%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI+FGL+SLP PI V KNLRVCNDCH + K VSKV+ REIIVRD+ RFHHF GG CS Sbjct: 983 LAISFGLLSLPATMPINVMKNLRVCNDCHDWIKFVSKVSNREIIVRDAYRFHHFEGGACS 1042 Query: 523 CDDYW 509 C DYW Sbjct: 1043 CKDYW 1047 >gb|ESW18386.1| hypothetical protein PHAVU_006G036400g [Phaseolus vulgaris] Length = 816 Score = 106 bits (264), Expect = 8e-21 Identities = 45/65 (69%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 +AIAFGL+S P + PI +FKNLRVC DCH+ TK +SK+T R+IIVRDSNRFHHF+ G CS Sbjct: 752 VAIAFGLISTPPKSPIRIFKNLRVCGDCHNATKYISKITERDIIVRDSNRFHHFKDGGCS 811 Query: 523 CDDYW 509 C DYW Sbjct: 812 CGDYW 816 >ref|XP_006282436.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] gi|565439136|ref|XP_006282437.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] gi|565439139|ref|XP_006282438.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] gi|482551141|gb|EOA15334.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] gi|482551142|gb|EOA15335.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] gi|482551143|gb|EOA15336.1| hypothetical protein CARUB_v10004043mg [Capsella rubella] Length = 1050 Score = 106 bits (264), Expect = 8e-21 Identities = 47/65 (72%), Positives = 52/65 (80%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI+FGL+SLP PI V KNLRVCNDCH + K VSKV+ REIIVRD+ RFHHF GG CS Sbjct: 986 LAISFGLLSLPRTMPINVMKNLRVCNDCHDWIKFVSKVSNREIIVRDAYRFHHFEGGACS 1045 Query: 523 CDDYW 509 C DYW Sbjct: 1046 CKDYW 1050 >ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 891 Score = 106 bits (264), Expect = 8e-21 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFG++S P + PI +FKNLRVC DCH+ TK +S++T REI+VRDSNRFHHF+ G CS Sbjct: 827 LAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICS 886 Query: 523 CDDYW 509 C DYW Sbjct: 887 CGDYW 891 >ref|XP_002975120.1| hypothetical protein SELMODRAFT_102603 [Selaginella moellendorffii] gi|300157279|gb|EFJ23905.1| hypothetical protein SELMODRAFT_102603 [Selaginella moellendorffii] Length = 485 Score = 106 bits (264), Expect = 8e-21 Identities = 45/65 (69%), Positives = 55/65 (84%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFGL+S P P+ + KNLRVC+DCH+ TK++SKVTGREI+VRD+NRFHHF G CS Sbjct: 421 LAIAFGLISTPPGAPLRIVKNLRVCSDCHAATKVISKVTGREILVRDTNRFHHFLDGMCS 480 Query: 523 CDDYW 509 C+DYW Sbjct: 481 CNDYW 485 >emb|CBI32403.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 106 bits (264), Expect = 8e-21 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFG++S P + PI +FKNLRVC DCH+ TK +S++T REI+VRDSNRFHHF+ G CS Sbjct: 594 LAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICS 653 Query: 523 CDDYW 509 C DYW Sbjct: 654 CGDYW 658 >emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] Length = 891 Score = 106 bits (264), Expect = 8e-21 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFG++S P + PI +FKNLRVC DCH+ TK +S++T REI+VRDSNRFHHF+ G CS Sbjct: 827 LAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICS 886 Query: 523 CDDYW 509 C DYW Sbjct: 887 CGDYW 891 >ref|XP_006410248.1| hypothetical protein EUTSA_v10016243mg [Eutrema salsugineum] gi|557111417|gb|ESQ51701.1| hypothetical protein EUTSA_v10016243mg [Eutrema salsugineum] Length = 844 Score = 105 bits (263), Expect = 1e-20 Identities = 47/65 (72%), Positives = 52/65 (80%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI+FGL+SLP PI V KNLRVCNDCH + K VSKV+ REIIVRD+ RFHHF GG CS Sbjct: 780 LAISFGLLSLPGTIPINVMKNLRVCNDCHDWIKFVSKVSNREIIVRDAYRFHHFEGGACS 839 Query: 523 CDDYW 509 C DYW Sbjct: 840 CKDYW 844 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 105 bits (263), Expect = 1e-20 Identities = 45/65 (69%), Positives = 53/65 (81%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAI FG++S P + PI +FKNLRVC DCH+ TK +SK+T REIIVRDSNRFHHF+ G CS Sbjct: 760 LAIVFGIISTPPKSPIRIFKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGICS 819 Query: 523 CDDYW 509 C DYW Sbjct: 820 CGDYW 824 >ref|XP_002978388.1| hypothetical protein SELMODRAFT_108652 [Selaginella moellendorffii] gi|300153737|gb|EFJ20374.1| hypothetical protein SELMODRAFT_108652 [Selaginella moellendorffii] Length = 687 Score = 105 bits (263), Expect = 1e-20 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIAFGL+S P + + +FKNLRVC DCH+ TK +SK+TGREI+VRD++RFHHFR G CS Sbjct: 623 LAIAFGLISTPEKSSLHIFKNLRVCEDCHTATKFISKITGREIVVRDNHRFHHFRDGSCS 682 Query: 523 CDDYW 509 C DYW Sbjct: 683 CKDYW 687 >ref|XP_001761392.1| predicted protein [Physcomitrella patens] gi|162687398|gb|EDQ73781.1| predicted protein [Physcomitrella patens] Length = 833 Score = 105 bits (262), Expect = 1e-20 Identities = 44/65 (67%), Positives = 56/65 (86%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIA+G++SLP+ PI ++KNLRVC+DCHS +K +SKVTGREII RD++RFHHF+ G CS Sbjct: 769 LAIAYGVLSLPSGTPIRIYKNLRVCSDCHSASKFISKVTGREIIARDASRFHHFKDGVCS 828 Query: 523 CDDYW 509 C DYW Sbjct: 829 CGDYW 833 >gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 820 Score = 105 bits (261), Expect = 2e-20 Identities = 44/65 (67%), Positives = 54/65 (83%) Frame = -3 Query: 703 LAIAFGLMSLPTRCPITVFKNLRVCNDCHSFTKMVSKVTGREIIVRDSNRFHHFRGGRCS 524 LAIA+G++S P + PI +FKNLRVC DCH+ TK +S++T REIIVRDSNRFHHF+ G CS Sbjct: 756 LAIAYGIISSPPKSPIRIFKNLRVCGDCHNATKFISQITDREIIVRDSNRFHHFKDGICS 815 Query: 523 CDDYW 509 C DYW Sbjct: 816 CGDYW 820