BLASTX nr result
ID: Zingiber24_contig00044925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044925 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK20778.1| cyclin dependent kinase regulator [Musa acuminata... 58 1e-06 >gb|AEK20778.1| cyclin dependent kinase regulator [Musa acuminata AAA Group] Length = 344 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = -2 Query: 154 MGPSFDYAPSILFCAEGNDSILGFDE-EEEGRRSPSWAPELKRRDFGRD 11 M PS D A SIL CAE NDSILGFD+ EEEG P W E KR DF D Sbjct: 1 MSPSCDCASSILLCAEDNDSILGFDDGEEEGGHRPGWVSEPKRCDFYGD 49