BLASTX nr result
ID: Zingiber24_contig00044742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044742 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006653667.1| PREDICTED: branched-chain-amino-acid aminotr... 55 1e-05 >ref|XP_006653667.1| PREDICTED: branched-chain-amino-acid aminotransferase 5, chloroplastic-like [Oryza brachyantha] Length = 396 Score = 55.1 bits (131), Expect = 1e-05 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = +2 Query: 74 ETLDLYWNHLGFRWVPTDYMHTMKCT*NGIFIEGELIHYG 193 + +D W LGF+WVPTD+M+ M+C+ G+F +GEL+ YG Sbjct: 59 DLVDFNWELLGFQWVPTDFMYVMRCSSEGVFTKGELVPYG 98