BLASTX nr result
ID: Zingiber24_contig00044455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044455 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlise... 65 7e-09 ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 57 3e-06 >gb|EPS74398.1| hypothetical protein M569_00361, partial [Genlisea aurea] Length = 56 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 116 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLLWTVTR 220 RDVAQLGSAFVLGTKCHGFKSCHPYLLLL V++ Sbjct: 1 RDVAQLGSAFVLGTKCHGFKSCHPYLLLLKRAVSQ 35 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 113 KRDVAQLGSAFVLGTKCHGFKSCHPYLLLLLW 208 +RDVAQLGS FVLGTKC FKSCHPYL LL + Sbjct: 3 RRDVAQLGSVFVLGTKCRRFKSCHPYLSLLFY 34