BLASTX nr result
ID: Zingiber24_contig00044369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044369 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA63929.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea m... 111 9e-23 tpg|DAA63924.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea m... 111 9e-23 ref|NP_001131793.1| uncharacterized protein LOC100193166 precurs... 111 9e-23 ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase ac... 110 2e-22 ref|XP_004958531.1| PREDICTED: mitochondrial ubiquitin ligase ac... 110 2e-22 ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase ac... 110 2e-22 tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea m... 110 2e-22 ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [S... 110 2e-22 gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indi... 110 2e-22 gb|EMJ02448.1| hypothetical protein PRUPE_ppa008230mg [Prunus pe... 108 7e-22 gb|EMS68860.1| Mitochondrial ubiquitin ligase activator of NFKB ... 107 1e-21 ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase ac... 107 1e-21 ref|XP_003562553.1| PREDICTED: mitochondrial ubiquitin ligase ac... 107 1e-21 ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase ac... 107 2e-21 ref|XP_006415226.1| hypothetical protein EUTSA_v10008106mg [Eutr... 106 4e-21 ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citr... 105 6e-21 ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase ac... 105 6e-21 ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase ac... 105 6e-21 ref|NP_176574.2| RING-type ubiquitin E3 ligase [Arabidopsis thal... 104 1e-20 gb|AAG52461.1|AC010852_18 putative RING zinc finger protein; 222... 104 1e-20 >tpg|DAA63929.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 343 Score = 111 bits (278), Expect = 9e-23 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCCV CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 343 >tpg|DAA63924.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 180 Score = 111 bits (278), Expect = 9e-23 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCCV CS HLT+CPLCR+RIDQA++TFRH Sbjct: 128 LVLDICVICLEQEYNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 180 >ref|NP_001131793.1| uncharacterized protein LOC100193166 precursor [Zea mays] gi|194692560|gb|ACF80364.1| unknown [Zea mays] gi|414887914|tpg|DAA63928.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 331 Score = 111 bits (278), Expect = 9e-23 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCCV CS HLT+CPLCR+RIDQA++TFRH Sbjct: 279 LVLDICVICLEQEYNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 331 >ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Oryza brachyantha] Length = 343 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFRH 343 >ref|XP_004958531.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X2 [Setaria italica] Length = 347 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 295 LVLDICVICLEQEYNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 347 >ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X1 [Setaria italica] Length = 343 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 343 >tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea mays] Length = 343 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 343 >ref|XP_002463293.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] gi|241926670|gb|EER99814.1| hypothetical protein SORBIDRAFT_02g041380 [Sorghum bicolor] Length = 343 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 343 >gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indica Group] gi|222637570|gb|EEE67702.1| hypothetical protein OsJ_25368 [Oryza sativa Japonica Group] Length = 343 Score = 110 bits (275), Expect = 2e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L LDICVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQA++TFRH Sbjct: 291 LVLDICVICLEQEYNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFRH 343 >gb|EMJ02448.1| hypothetical protein PRUPE_ppa008230mg [Prunus persica] Length = 340 Score = 108 bits (270), Expect = 7e-22 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLE EYNAVFVPCGHMCCC TCS+HLT+CPLCR+RIDQA+KTFRH Sbjct: 291 DLCVICLEHEYNAVFVPCGHMCCCTTCSLHLTNCPLCRRRIDQAVKTFRH 340 >gb|EMS68860.1| Mitochondrial ubiquitin ligase activator of NFKB 1 [Triticum urartu] Length = 341 Score = 107 bits (268), Expect = 1e-21 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L L+ICVICLEQEYNAVFVPCGHMCCC+ CS H+T+CPLCR+RIDQA++TFRH Sbjct: 289 LVLEICVICLEQEYNAVFVPCGHMCCCMNCSSHVTNCPLCRRRIDQAVRTFRH 341 >ref|XP_003562554.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 2 [Brachypodium distachyon] Length = 331 Score = 107 bits (268), Expect = 1e-21 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L L+ICVICLEQEYNAVFVPCGHMCCC+ CS H+T+CPLCR+RIDQA++TFRH Sbjct: 279 LVLEICVICLEQEYNAVFVPCGHMCCCMNCSSHVTNCPLCRRRIDQAVRTFRH 331 >ref|XP_003562553.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Brachypodium distachyon] Length = 343 Score = 107 bits (268), Expect = 1e-21 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = +3 Query: 6 LALDICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 L L+ICVICLEQEYNAVFVPCGHMCCC+ CS H+T+CPLCR+RIDQA++TFRH Sbjct: 291 LVLEICVICLEQEYNAVFVPCGHMCCCMNCSSHVTNCPLCRRRIDQAVRTFRH 343 >ref|XP_004290684.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Fragaria vesca subsp. vesca] Length = 342 Score = 107 bits (267), Expect = 2e-21 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYNAVFVPCGHMCCC TCS+HLT+CPLCR+RI+Q +KTFRH Sbjct: 293 DLCVICLEQEYNAVFVPCGHMCCCTTCSLHLTNCPLCRRRIEQVVKTFRH 342 >ref|XP_006415226.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145364|ref|XP_006415228.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145367|ref|XP_006415229.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|567145371|ref|XP_006415230.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] gi|557092997|gb|ESQ33579.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557092999|gb|ESQ33581.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557093000|gb|ESQ33582.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] gi|557093001|gb|ESQ33583.1| hypothetical protein EUTSA_v10008106mg [Eutrema salsugineum] Length = 344 Score = 106 bits (264), Expect = 4e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYNAVFVPCGHMCCC CS HLTSCPLCR+RIDQ +KT+RH Sbjct: 295 DLCVICLEQEYNAVFVPCGHMCCCTACSCHLTSCPLCRRRIDQVVKTYRH 344 >ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|567903312|ref|XP_006444144.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|568852219|ref|XP_006479777.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Citrus sinensis] gi|557546405|gb|ESR57383.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|557546406|gb|ESR57384.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] Length = 344 Score = 105 bits (262), Expect = 6e-21 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYNAVFVPCGHMCCC+ CS HLT+CPLCR+RIDQ ++TFRH Sbjct: 295 DLCVICLEQEYNAVFVPCGHMCCCIICSSHLTNCPLCRRRIDQVVRTFRH 344 >ref|XP_004242326.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 2 [Solanum lycopersicum] Length = 341 Score = 105 bits (262), Expect = 6e-21 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYN+VFVPCGHMCCC+TCS HLT+CPLCR+RI+Q +KTFRH Sbjct: 292 DLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 341 >ref|XP_004242325.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform 1 [Solanum lycopersicum] Length = 349 Score = 105 bits (262), Expect = 6e-21 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYN+VFVPCGHMCCC+TCS HLT+CPLCR+RI+Q +KTFRH Sbjct: 300 DLCVICLEQEYNSVFVPCGHMCCCMTCSSHLTNCPLCRRRIEQVVKTFRH 349 >ref|NP_176574.2| RING-type ubiquitin E3 ligase [Arabidopsis thaliana] gi|22135946|gb|AAM91555.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|23197600|gb|AAN15327.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|51970568|dbj|BAD43976.1| unknown protein [Arabidopsis thaliana] gi|51971707|dbj|BAD44518.1| unknown protein [Arabidopsis thaliana] gi|332196043|gb|AEE34164.1| RING-type ubiquitin E3 ligase [Arabidopsis thaliana] Length = 343 Score = 104 bits (260), Expect = 1e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYNAVFVPCGHMCCC CS HLTSCPLCR+RID A+KT+RH Sbjct: 294 DLCVICLEQEYNAVFVPCGHMCCCTACSSHLTSCPLCRRRIDLAVKTYRH 343 >gb|AAG52461.1|AC010852_18 putative RING zinc finger protein; 22238-21626 [Arabidopsis thaliana] gi|66865910|gb|AAY57589.1| RING finger family protein [Arabidopsis thaliana] Length = 115 Score = 104 bits (260), Expect = 1e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 15 DICVICLEQEYNAVFVPCGHMCCCVTCSVHLTSCPLCRKRIDQAIKTFRH 164 D+CVICLEQEYNAVFVPCGHMCCC CS HLTSCPLCR+RID A+KT+RH Sbjct: 66 DLCVICLEQEYNAVFVPCGHMCCCTACSSHLTSCPLCRRRIDLAVKTYRH 115