BLASTX nr result
ID: Zingiber24_contig00044279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044279 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458339.1| hypothetical protein SORBIDRAFT_03g031640 [S... 56 6e-06 ref|XP_004235780.1| PREDICTED: probable serine/threonine-protein... 55 1e-05 >ref|XP_002458339.1| hypothetical protein SORBIDRAFT_03g031640 [Sorghum bicolor] gi|241930314|gb|EES03459.1| hypothetical protein SORBIDRAFT_03g031640 [Sorghum bicolor] Length = 692 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = +1 Query: 157 SCPNSTPALCGGVNISYPFWKSSDFLQNNNTYCGYQGFNVTCESPYYT--PILLLGND 324 S S P LCGGVNISYPF+ +SD + +YCGY G VTC++ P+L LG D Sbjct: 37 SACRSRPYLCGGVNISYPFYLASD---DGESYCGYPGLAVTCDNNNNNRRPVLKLGGD 91 >ref|XP_004235780.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like [Solanum lycopersicum] Length = 663 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = +1 Query: 160 CPNSTPALCGGVNISYPFWKSSDFLQNNNTYCGYQGFNVTCESPYYTPILLLGND 324 CP ST C GV ISYPFW+ ++ + YCGY GF + C PI+ L +D Sbjct: 37 CPKST---CNGVEISYPFWRLDNYNTSAPQYCGYPGFGINCSENQPLPIIYLPSD 88