BLASTX nr result
ID: Zingiber24_contig00044085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044085 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_003946934.1| conserved hypothetical protein, partial [Str... 56 4e-13 ref|WP_009191005.1| hypothetical protein, partial [Streptomyces ... 56 1e-07 ref|WP_003948852.1| conserved hypothetical protein, partial [Str... 56 6e-06 >ref|WP_003946934.1| conserved hypothetical protein, partial [Streptomyces albus] gi|291353151|gb|EFE80053.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces albus J1074] Length = 104 Score = 55.8 bits (133), Expect(3) = 4e-13 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 253 ELARGFSRQHRIIQFASFGYASGLTLVPCGFTYTTGHTLAPVLPLTG 113 +LARGFSRQHRII F + G ASGL+ + GFTY T +TL P P G Sbjct: 23 KLARGFSRQHRIIHFTTIGSASGLSHMYDGFTYRTAYTLTPGQPPPG 69 Score = 34.7 bits (78), Expect(3) = 4e-13 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 110 DYLPASPHRLPTTSPCPAFHQIR-PEGQSPAS 18 DYLPASPH PTTS H PEG AS Sbjct: 71 DYLPASPHHSPTTSSGHRLHHFPFPEGSGTAS 102 Score = 29.3 bits (64), Expect(3) = 4e-13 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 300 YSLPDHLSWFGVRAAKNSLEAF 235 YSLPDHLS F VRAA F Sbjct: 7 YSLPDHLSRFRVRAAMKLARGF 28 >ref|WP_009191005.1| hypothetical protein, partial [Streptomyces sp. e14] gi|292835114|gb|EFF93463.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_03782 [Streptomyces sp. e14] Length = 112 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 32/47 (68%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 252 NSLEAFLGSIGSSNSPHSAMRQAS-PWCRADLPTRRATPLHRYYHSP 115 NSLEAFL SIGSS SP SA Q S WC ADLPT R TPL R H P Sbjct: 1 NSLEAFLDSIGSSTSPQSARHQVSDTWC-ADLPTHRPTPLPRDNHRP 46 Score = 25.0 bits (53), Expect(2) = 1e-07 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 115 GRTTFLRHPIACLLPVRVPRST 50 G TTFLRHPI LL ST Sbjct: 47 GWTTFLRHPITHLLTAWFSGST 68 >ref|WP_003948852.1| conserved hypothetical protein, partial [Streptomyces albus] gi|291355072|gb|EFE81974.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces albus J1074] Length = 89 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = -2 Query: 252 NSLEAFLGSIGSSNSPHSAMRQASPWCRADLPTRRATPLHRYYHSP 115 NSLEAFL SIGSS SP SA Q S C DLP R TPL R H P Sbjct: 1 NSLEAFLDSIGSSTSPQSARHQVSATCTTDLPIARPTPLPRDNHRP 46