BLASTX nr result
ID: Zingiber24_contig00044059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044059 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 56 4e-06 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -2 Query: 292 KYRHDFFFGTAVQMARIMLRIHYSRLFWQLFGVFNYENHEGNPRI 158 KY+ AV + IMLRI YSRL W LFGVF+YENHEG PRI Sbjct: 16 KYQEFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRI 60