BLASTX nr result
ID: Zingiber24_contig00044036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00044036 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGY49283.1| chloroplast terpene synthase [Hedychium coronarium] 77 2e-12 gb|AER12203.1| chloroplast linalool synthase [Hedychium coccineum] 61 2e-07 >gb|AGY49283.1| chloroplast terpene synthase [Hedychium coronarium] Length = 591 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/73 (57%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = +2 Query: 47 MSPSLVAPSYIPFHLKLCDLRRSTTTERP-CFPLIHCTASRQSP-ALGKSTHYRPNSWSN 220 MS L PSY PF LRRST ++P C L+ CTA RQSP A +S HY+PN WS+ Sbjct: 1 MSLLLAPPSYFPFR----GLRRSTAAKQPPCLRLVKCTADRQSPEAARRSAHYQPNMWSD 56 Query: 221 DYIQSLTVKSPLQ 259 DYIQSLTV+SPL+ Sbjct: 57 DYIQSLTVESPLK 69 >gb|AER12203.1| chloroplast linalool synthase [Hedychium coccineum] Length = 591 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = +2 Query: 62 VAPSYIPFHLKLCDLRR-STTTERPCFPLIHCTASR-QSPALGKSTHYRPNSWSNDYIQS 235 VAP + F L LRR +TT ++PC LI CT Q+PA +S +Y+PN W +D I+S Sbjct: 8 VAPLNLAFDRHLFALRRCATTVKQPCLTLIRCTDDAGQTPASRRSANYQPNLWGDDRIRS 67 Query: 236 LTVKSPLQE 262 LTV SP++E Sbjct: 68 LTVDSPVEE 76