BLASTX nr result
ID: Zingiber24_contig00043731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043731 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT30147.1| hypothetical protein F775_13012 [Aegilops tauschii] 93 4e-17 ref|XP_004974842.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 tpg|DAA47998.1| TPA: hypothetical protein ZEAMMB73_181337 [Zea m... 92 9e-17 ref|XP_002444760.1| hypothetical protein SORBIDRAFT_07g027560 [S... 92 9e-17 gb|EEC80597.1| hypothetical protein OsI_22944 [Oryza sativa Indi... 92 9e-17 dbj|BAG94654.1| unnamed protein product [Oryza sativa Japonica G... 92 9e-17 ref|NP_001057622.1| Os06g0472300 [Oryza sativa Japonica Group] g... 92 9e-17 ref|XP_006656970.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_003572374.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_006486584.1| PREDICTED: pentatricopeptide repeat-containi... 89 5e-16 ref|XP_006422411.1| hypothetical protein CICLE_v10028001mg [Citr... 89 5e-16 gb|EMJ02387.1| hypothetical protein PRUPE_ppa002996mg [Prunus pe... 89 6e-16 ref|XP_004504725.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_004290083.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 emb|CBI37724.3| unnamed protein product [Vitis vinifera] 86 4e-15 ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_006580029.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 gb|EMS45170.1| hypothetical protein TRIUR3_26201 [Triticum urartu] 85 1e-14 gb|EOX98930.1| Pentatricopeptide repeat (PPR) superfamily protei... 84 2e-14 >gb|EMT30147.1| hypothetical protein F775_13012 [Aegilops tauschii] Length = 674 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH+F KLV+KSE IIIRD VRFHHF+DGVCSCGDYW Sbjct: 627 IMKNLRICGDCHSFVKLVSKSEGKVIIIRDPVRFHHFQDGVCSCGDYW 674 >ref|XP_004974842.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Setaria italica] Length = 641 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE IIIRD VRFHHF+DG CSCGDYW Sbjct: 594 IMKNLRICGDCHAFAKLVSKSEGKVIIIRDPVRFHHFQDGTCSCGDYW 641 >tpg|DAA47998.1| TPA: hypothetical protein ZEAMMB73_181337 [Zea mays] Length = 639 Score = 91.7 bits (226), Expect = 9e-17 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE I+IRD VRFHHF+DG CSCGDYW Sbjct: 592 IMKNLRICGDCHAFAKLVSKSEGRVIVIRDPVRFHHFQDGACSCGDYW 639 >ref|XP_002444760.1| hypothetical protein SORBIDRAFT_07g027560 [Sorghum bicolor] gi|241941110|gb|EES14255.1| hypothetical protein SORBIDRAFT_07g027560 [Sorghum bicolor] Length = 650 Score = 91.7 bits (226), Expect = 9e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE IIIRD VRFHHF+DG CSCGDYW Sbjct: 603 IMKNLRICGDCHAFAKLVSKSEGRMIIIRDPVRFHHFQDGACSCGDYW 650 >gb|EEC80597.1| hypothetical protein OsI_22944 [Oryza sativa Indica Group] Length = 563 Score = 91.7 bits (226), Expect = 9e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE IIIRD VRFHHF+DGVCSC DYW Sbjct: 516 IMKNLRICGDCHAFAKLVSKSEGKVIIIRDPVRFHHFQDGVCSCNDYW 563 >dbj|BAG94654.1| unnamed protein product [Oryza sativa Japonica Group] gi|222635568|gb|EEE65700.1| hypothetical protein OsJ_21333 [Oryza sativa Japonica Group] Length = 382 Score = 91.7 bits (226), Expect = 9e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE IIIRD VRFHHF+DGVCSC DYW Sbjct: 335 IMKNLRICGDCHAFAKLVSKSEGKVIIIRDPVRFHHFQDGVCSCNDYW 382 >ref|NP_001057622.1| Os06g0472300 [Oryza sativa Japonica Group] gi|113595662|dbj|BAF19536.1| Os06g0472300, partial [Oryza sativa Japonica Group] Length = 397 Score = 91.7 bits (226), Expect = 9e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+KSE IIIRD VRFHHF+DGVCSC DYW Sbjct: 350 IMKNLRICGDCHAFAKLVSKSEGKVIIIRDPVRFHHFQDGVCSCNDYW 397 >ref|XP_006656970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Oryza brachyantha] Length = 691 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH F KLV+KSE IIIRD VRFHHF+DGVCSC DYW Sbjct: 644 IMKNLRICGDCHAFVKLVSKSEGKVIIIRDPVRFHHFQDGVCSCNDYW 691 >ref|XP_003572374.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Brachypodium distachyon] Length = 642 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 IMKNLRICGDCH FAKLV+K+E IIIRD VRFHHF+ GVCSCGDYW Sbjct: 595 IMKNLRICGDCHAFAKLVSKTEGKAIIIRDPVRFHHFQHGVCSCGDYW 642 >ref|XP_006486584.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Citrus sinensis] Length = 645 Score = 89.4 bits (220), Expect = 5e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCHTFAKL AK E TI+IRD +R+HHF+DG CSCGDYW Sbjct: 598 IRKNLRICGDCHTFAKLTAKMENQTIVIRDPIRYHHFQDGNCSCGDYW 645 >ref|XP_006422411.1| hypothetical protein CICLE_v10028001mg [Citrus clementina] gi|557524345|gb|ESR35651.1| hypothetical protein CICLE_v10028001mg [Citrus clementina] Length = 643 Score = 89.4 bits (220), Expect = 5e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCHTFAKL AK E TI+IRD +R+HHF+DG CSCGDYW Sbjct: 596 IRKNLRICGDCHTFAKLTAKMENQTIVIRDPIRYHHFQDGNCSCGDYW 643 >gb|EMJ02387.1| hypothetical protein PRUPE_ppa002996mg [Prunus persica] Length = 613 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCH FAKLVAK E I+IRD +R+HHF+DGVCSCGDYW Sbjct: 566 IRKNLRICGDCHIFAKLVAKMEERVIVIRDPIRYHHFQDGVCSCGDYW 613 >ref|XP_004504725.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cicer arietinum] Length = 632 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNL+ICGDCH FAKL+AK E+ I+IRD +R+HHF+DGVCSCGDYW Sbjct: 585 IWKNLKICGDCHIFAKLIAKLEQRHIVIRDPIRYHHFQDGVCSCGDYW 632 >ref|XP_004290083.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 585 Score = 86.7 bits (213), Expect = 3e-15 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 + KNLRICGDCH FAKLVAK ++ TI+IRD +R+HHF+DG CSCGDYW Sbjct: 538 VRKNLRICGDCHEFAKLVAKLKQRTIVIRDPIRYHHFQDGECSCGDYW 585 >ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 654 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCH F KL+A+ ER +I+IRD +R+HHF+DG+CSCGDYW Sbjct: 607 IRKNLRICGDCHLFVKLLAQIERRSIVIRDPIRYHHFQDGICSCGDYW 654 >emb|CBI37724.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCH FAK+V++ E +I+IRD +R+HHF+DGVCSCGDYW Sbjct: 292 IRKNLRICGDCHVFAKVVSRMEHRSIVIRDPIRYHHFQDGVCSCGDYW 339 >ref|XP_002279974.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Vitis vinifera] Length = 623 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCH FAK+V++ E +I+IRD +R+HHF+DGVCSCGDYW Sbjct: 576 IRKNLRICGDCHVFAKVVSRMEHRSIVIRDPIRYHHFQDGVCSCGDYW 623 >ref|XP_006580029.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Glycine max] Length = 637 Score = 85.1 bits (209), Expect = 9e-15 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNL+ICGDCH FAKL+A+ E+ I+IRD +R+HHF+DGVCSCGDYW Sbjct: 590 IWKNLKICGDCHKFAKLIAELEQRHIVIRDPIRYHHFQDGVCSCGDYW 637 >gb|EMS45170.1| hypothetical protein TRIUR3_26201 [Triticum urartu] Length = 284 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 +MKNLRICGDCHT KL+AK II+RD+ RFHHFKDG CSCGDYW Sbjct: 237 VMKNLRICGDCHTAVKLIAKVTGREIIVRDNKRFHHFKDGACSCGDYW 284 >gb|EOX98930.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 642 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +3 Query: 3 IMKNLRICGDCHTFAKLVAKSERVTIIIRDHVRFHHFKDGVCSCGDYW 146 I KNLRICGDCH FAK VAK E I+IRD +R+HHF++GVCSCGDYW Sbjct: 595 IRKNLRICGDCHNFAKFVAKMECRLIVIRDPIRYHHFQNGVCSCGDYW 642