BLASTX nr result
ID: Zingiber24_contig00043473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043473 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006660201.1| PREDICTED: serrate RNA effector molecule hom... 57 2e-06 >ref|XP_006660201.1| PREDICTED: serrate RNA effector molecule homolog [Oryza brachyantha] Length = 172 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 1 SMLDEAIQYVKFLKTQVQSLERAAVSQRMLPPVAYGPPFDGICYP 135 SMLDEAI YVKFLKTQVQSLERAA + PP PP D + YP Sbjct: 126 SMLDEAIHYVKFLKTQVQSLERAAAANGHRPP----PPTDAVAYP 166