BLASTX nr result
ID: Zingiber24_contig00043269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber24_contig00043269 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32720.1| hypothetical protein L484_019833 [Morus notabilis] 55 1e-05 >gb|EXC32720.1| hypothetical protein L484_019833 [Morus notabilis] Length = 415 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 125 EPLQYSRINAKDLKMQIVKNLGRERSQRYFVFLNGLLAQKL 3 +P QYSRI+ DLK Q+VK +G E+S+RYF +LN LL+QKL Sbjct: 2 QPQQYSRIDLADLKAQLVKRIGAEKSKRYFYYLNKLLSQKL 42